KEGG   Taeniopygia guttata (zebra finch): 100226824Help
Entry
100226824         CDS       T01082                                 

Gene name
DLST
Definition
(RefSeq) dihydrolipoamide S-succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00020  Citrate cycle (TCA cycle)
tgu00310  Lysine degradation
tgu01100  Metabolic pathways
tgu01200  Carbon metabolism
Module
tgu_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100226824 (DLST)
  Amino acid metabolism
   00310 Lysine degradation
    100226824 (DLST)
Enzymes [BR:tgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     100226824 (DLST)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 GCV_H HlyD_D23
Motif
Other DBs
NCBI-GeneID: 100226824
NCBI-ProteinID: XP_002199962
Ensembl: ENSTGUG00000012171
Position
5
AA seq 489 aa AA seqDB search
MAVSPRVPLLRGRARPRGKGAAPAEPGGGKGWREGLRAAPRSGSAGPPVSGIWGPRCWQP
PACAGRDPPAGARRCGTGSNRRAGNCTLARCPLSGVSGSQGLAYTNSRKLVVNSSSVFTV
RYFRTTAVHRDDVVTVNTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPA
PAAGVIEALLVPDGGKVEGGTPLFKLRKTGAAPAKAKPAAAPPPPAAPEPVAAPAPPPAA
APIPTTMPPVPPVSTQPIDSKPVSAVKPAAAPAAAPPGEAVPTKGARSEHRVKMNRMRQR
IAQRLKEAQNTCAMLTTFNEIDMSNIREMRAVHKDTFLKKHNLKLGFMSAFVKAAAFALQ
DQPVVNAVIDDTTKEIVYRDYVDISVAVATPRGLVVPVVRNVENMNFADIERAIYELGEK
ARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHAIFDRPVAVGGKVGGP
AQEVLGNER
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggccgtttccccgcgggtgccgctgctccgcggccgggcccggccccgcgggaagggc
gcggcaccggcagagccgggcggcgggaagggctggcgggaagggctgcgagcggcgccg
cgctcgggctccgccggcccgcccgtcagcggcatttggggccctcgctgctggcagcca
ccggcctgcgctggcagagaccccccggccggggcgcgccggtgcgggaccggcagcaac
cggcgtgcggggaactgtactctggcaagatgccctctgtctggtgtgtctgggagccaa
ggactggcttacacaaacagcaggaagcttgtagtaaatagctccagtgtcttcactgtc
cgctacttcagaaccactgcggtacatagggatgacgtggttacggtgaacacaccagcc
tttgcagagtcagtcacagaaggagatgtcaggtgggagaaagctgttggagacacagtg
gcggaagatgaagtggtgtgtgagattgaaacagacaagacatcagtgcaagttccagcc
ccagcagctggtgtgattgaagcccttctggtacccgatggtggcaaagtggaagggggg
acacctctattcaaactcaggaaaactggagctgctcctgccaaggctaaaccagcagca
gcccctcctcctcctgcagcccctgaacctgtagctgcgcctgctcctccccctgctgca
gcaccaattcccactacgatgccaccagtgccgcctgtgtcaactcagcccatcgacagc
aaaccagtgtctgctgtgaagccggctgcagccccagcggcagcccctcctggggaggca
gtgcccaccaaaggtgccagatcagagcatagggtgaaaatgaataggatgcgtcagcgt
attgctcagcggctgaaagaggctcagaatacttgtgccatgctgaccactttcaatgag
attgatatgagcaacatccgggagatgagagctgtacacaaggatacctttctgaaaaag
cacaacttgaagctaggtttcatgtcagcttttgtgaaagctgcagcctttgctctgcag
gaccagcctgttgtgaatgcagtgattgatgacacgaccaaagagattgtgtacagggac
tatgtggacatcagtgttgctgtagcaactccccggggtctggtggtccctgtggttagg
aatgtagaaaacatgaactttgctgacatagaacgtgctatctacgagttgggggagaag
gcacggaagaatgaactggccattgaagacatggatggtggcactttcacaatcagcaat
ggtggagtttttgggtcactctttggaacacctatcattaacccaccccagtctgccatc
ttaggcatgcatgccatctttgacaggcctgtggctgtgggaggcaaggtaggtggacct
gcacaggaggttttagggaacgaaagatag

DBGET integrated database retrieval system