KEGG   Taeniopygia guttata (zebra finch): 100226824Help
Entry
100226824         CDS       T01082                                 

Gene name
DLST
Definition
dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tgu01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:tgu00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:tgu00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 489 aa AA seqDB search
MAVSPRVPLLRGRARPRGKGAAPAEPGGGKGWREGLRAAPRSGSAGPPVSGIWGPRCWQP
PACAGRDPPAGARRCGTGSNRRAGNCTLARCPLSGVSGSQGLAYTNSRKLVVNSSSVFTV
RYFRTTAVHRDDVVTVNTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPA
PAAGVIEALLVPDGGKVEGGTPLFKLRKTGAAPAKAKPAAAPPPPAAPEPVAAPAPPPAA
APIPTTMPPVPPVSTQPIDSKPVSAVKPAAAPAAAPPGEAVPTKGARSEHRVKMNRMRQR
IAQRLKEAQNTCAMLTTFNEIDMSNIREMRAVHKDTFLKKHNLKLGFMSAFVKAAAFALQ
DQPVVNAVIDDTTKEIVYRDYVDISVAVATPRGLVVPVVRNVENMNFADIERAIYELGEK
ARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHAIFDRPVAVGGKVGGP
AQEVLGNER
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggccgtttccccgcgggtgccgctgctccgcggccgggcccggccccgcgggaagggc
gcggcaccggcagagccgggcggcgggaagggctggcgggaagggctgcgagcggcgccg
cgctcgggctccgccggcccgcccgtcagcggcatttggggccctcgctgctggcagcca
ccggcctgcgctggcagagaccccccggccggggcgcgccggtgcgggaccggcagcaac
cggcgtgcggggaactgtactctggcaagatgccctctgtctggtgtgtctgggagccaa
ggactggcttacacaaacagcaggaagcttgtagtaaatagctccagtgtcttcactgtc
cgctacttcagaaccactgcggtacatagggatgacgtggttacggtgaacacaccagcc
tttgcagagtcagtcacagaaggagatgtcaggtgggagaaagctgttggagacacagtg
gcggaagatgaagtggtgtgtgagattgaaacagacaagacatcagtgcaagttccagcc
ccagcagctggtgtgattgaagcccttctggtacccgatggtggcaaagtggaagggggg
acacctctattcaaactcaggaaaactggagctgctcctgccaaggctaaaccagcagca
gcccctcctcctcctgcagcccctgaacctgtagctgcgcctgctcctccccctgctgca
gcaccaattcccactacgatgccaccagtgccgcctgtgtcaactcagcccatcgacagc
aaaccagtgtctgctgtgaagccggctgcagccccagcggcagcccctcctggggaggca
gtgcccaccaaaggtgccagatcagagcatagggtgaaaatgaataggatgcgtcagcgt
attgctcagcggctgaaagaggctcagaatacttgtgccatgctgaccactttcaatgag
attgatatgagcaacatccgggagatgagagctgtacacaaggatacctttctgaaaaag
cacaacttgaagctaggtttcatgtcagcttttgtgaaagctgcagcctttgctctgcag
gaccagcctgttgtgaatgcagtgattgatgacacgaccaaagagattgtgtacagggac
tatgtggacatcagtgttgctgtagcaactccccggggtctggtggtccctgtggttagg
aatgtagaaaacatgaactttgctgacatagaacgtgctatctacgagttgggggagaag
gcacggaagaatgaactggccattgaagacatggatggtggcactttcacaatcagcaat
ggtggagtttttgggtcactctttggaacacctatcattaacccaccccagtctgccatc
ttaggcatgcatgccatctttgacaggcctgtggctgtgggaggcaaggtaggtggacct
gcacaggaggttttagggaacgaaagatag

DBGET integrated database retrieval system