KEGG   Taeniopygia guttata (zebra finch): 100227070Help
Entry
100227070         CDS       T01082                                 

Gene name
ADRA1A
Definition
adrenoceptor alpha 1A
Orthology
K04135  
adrenergic receptor alpha-1A
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100227070 (ADRA1A)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100227070 (ADRA1A)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100227070 (ADRA1A)
   04270 Vascular smooth muscle contraction
    100227070 (ADRA1A)
G protein-coupled receptors [BR:tgu04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    100227070 (ADRA1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
22
AA seq 464 aa AA seqDB search
MALLPGNSSECSNCTHSVEPVNISKAILLGVILGGLIGFGVLGNILVILSVACHRHLQSV
THYYIINLAVADLLLTSTVLPFSATMEILGYWVFGRIFCNIWAAVDVLCCTASIMSLCVI
SIDRYIGVSYPLRYPSIVTERRGLLALLCVWALSLVISIGPLFGWKEPAPEDETICQITE
EPGYVLFSALGSFYLPLIIILVMYCRVYVVAKRENKGLTCGLKTEKSRSEEVTLRIHRKN
ARGASGSTPNPKSKHHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFVVMPLGSFFPA
IKPPDTLFKITFWLGYLNSCINPIIYPCSSQEFKKAFHNVLRAQCLLRKQPAVKQTPSFN
LNHPAGESTESGKGVVRIPVGSGETFYKISKSDGVCEWKIFSTVQGAPAKNAVSKDCTAA
KAKSKGFLQECCCAGTSGSLIRENCKVPTTKIHSISLSESGEDV
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggctctcctccctggaaactcttccgaatgctccaactgcacccactctgtggagcct
gtgaacatttccaaggccatcttactgggtgttattctaggggggctgattggttttggg
gttttgggtaatatcctggtgatcctgtccgtagcctgccacagacatctacagagtgtc
acccactattacatcatcaacctggctgtagctgacctcctcctgacttctaccgtcctg
cccttctcagctaccatggagattttgggctactgggtcttcgggaggatcttctgcaac
atctgggcagctgtcgacgtgctttgctgcacggcttccatcatgagcctctgcgtcatc
tccatcgaccgatacattggggtgagctacccactgaggtaccccagcatagtgacagag
aggaggggcctgctggccctgctgtgtgtctgggcactgtccctggtcatctccatcggg
ccccttttcggctggaaggagccagccccggaggatgagaccatctgccagatcaccgag
gaacccggctacgtcttgttctcagctctgggctccttctacctccccctgatcatcatc
ttggtgatgtactgccgggtctacgtggtggccaaaagggaaaacaaagggttgacctgt
gggctgaagacggagaaatcccgttctgaggaggtgacgctccgcatccaccgcaaaaac
gcacgcggtgcgagcggctccacgcccaaccccaagagcaagcaccacttctccgtgcgc
ctgctcaagttctccagggaaaaaaaagctgccaagaccctgggaatagttgtgggatgc
ttcgttctctgctggctcccgttttttgtagtaatgcctctcggctctttctttcctgca
atcaaacccccggacacactttttaaaataacattttggctgggatatttaaacagctgc
atcaaccccatcatctatccatgctcaagtcaggagttcaagaaagcgttccacaacgtc
ctgagagctcagtgcctcctgaggaagcagccagcagtgaagcaaacccccagcttcaac
ctcaaccatcctgctggcgagagcacggagagtggcaaaggggtggtgcggatccccgtg
ggatcaggagaaaccttctacaagatttccaaatccgacggggtctgcgagtggaagatc
ttctctaccgtgcagggcgcgcccgccaaaaacgccgtttccaaagactgcacagctgct
aaggccaagagcaaagggttcctgcaggaatgctgctgtgcaggcacttctgggagtctc
atccgagagaactgcaaagtgccaaccactaaaatccactccatctccctgagcgagagc
ggggaggatgtataa

  All links  
No link information was found.   
DBGET integrated database retrieval system