KEGG   Taeniopygia guttata (zebra finch): 100227204Help
Entry
100227204         CDS       T01082                                 

Definition
sphingosine kinase 1-like
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100227204
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    100227204
   04020 Calcium signaling pathway
    100227204
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     100227204
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 305 aa AA seqDB search
MLAEADIATTVFITERPHHAHEKVRDEDLSQWDTLVVVSGDGLLFEVVNGLMERPDWKEA
MKKPLCILPGGSGNALAASINYYAGYDHVAKKKLLTNCTFILCKGLYTQMDLVSLSTASG
KRFFSFLGFGWGFISDVDIDSEKYRWLGSARFTLGTLQCLAKLRVYQGRLSYLPVAPAGT
EAPGSPPPDSLLVPLGQPVPPHWTVVPEEEFVLVYAIYQSHLGTNLLMAPAARLHDGCIH
LFYMKAGISRVTLLKLFLAMSRGTHLDLNCPHLSYVPVRAFRLEPRVAAGIMTVDGEALV
CEPVQ
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgctggctgaggctgacattgccaccactgtcttcatcaccgaaagaccccaccatgcg
cacgagaaggtgcgagatgaggacctgtcgcagtgggacacgttggtggtcgtgtctggg
gacgggctgctgttcgaggtggtgaacgggctgatggagcgtccggactggaaggaggcc
atgaagaagccgctgtgcatcctgccaggaggctctgggaacgccctggctgcctctatc
aactactatgcaggctacgaccacgttgccaagaaaaagctgctgacgaactgcaccttc
atcctgtgcaaggggctgtacacgcagatggacctggtgtcgctgagcacggcctcgggc
aagcgcttcttctccttcctgggctttggctggggcttcatctcggacgtggacatcgac
agcgagaagtaccgctggctgggcagcgcccgcttcaccctgggcacgctgcagtgcctg
gccaagctccgggtgtaccagggccgcctgtcctacctgcccgtggcccccgcgggcacc
gaggcgcccggctcgccgccccccgactcgctgctggtgccgctgggccagcccgtgccg
ccgcactggaccgtggtccccgaggaggagttcgtcctggtctacgccatctaccagtcc
cacctgggcaccaacctgctgatggcaccggcggcccggctgcacgacggctgcatccac
ctcttctacatgaaggccggcatcagccgcgtgacgctgctgaagctcttcctggccatg
tccagggggacccacctggacttgaactgtccccacctgtcctacgtcccggtgcgggcg
ttccgcctggagccgcgcgtggccgcgggcatcatgacggtggatggagaggcgctggtc
tgcgagcccgtgcag

DBGET integrated database retrieval system