KEGG   Taeniopygia guttata (zebra finch): 100227212Help
Entry
100227212         CDS       T01082                                 

Definition
nuclear receptor coactivator 1-like
Orthology
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100227212
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 436 aa AA seqDB search
FQSCLICIARRLPRPTPAPAPAESFVTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIY
AFFQPQGREPSYAKQLFQEVMTRGTAFSPSYRFTLSDGSVLSAHTKCKLCYPSSPELQPF
IMGVHIIDRDHGILSLQDAPAPGPALPRVNPNVSPAPGTAPNGNFGNAPGSTVALSQTPA
NSHPLSHGSPGMAPPPFPSPRHRGSPASIPRCRAPAGNSFPPSALSPSSSGNSRPFPGAD
PPANPAFLRQNSPGRAGKTELKDSKEISTVLGEVIHENEKTPETGIPGIPGGSDGGVGDT
GKCPQGTSHRLVQLLASTAEAQLRHRADAADAAASKDSLACAGVPGGSVGAAPAPCPASH
GSLNERHKILHRLLQEGGPCDGAEEKRENLAGSGAEADKMKESKDHQLLRYLLDKDENGN
AGGDPNNDPGGGFRQR
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atttccagtcctgcctgatctgcatcgcccggaggctgccgcgcccgaccccggccccgg
ccccggccgagtccttcgtcaccaagcaggacaccacaggaaaaatcatctccatcgaca
ccagctcgctgcgcgccgcgggccggacgggctgggaggatctggtgcggaaatgcatct
acgccttcttccagccccagggccgcgagccctcctacgccaagcagctcttccaggaag
tgatgacgcggggcacggccttcagcccctcgtaccgcttcacgctgagcgacggctccg
tgctgagcgcccacaccaagtgcaagctctgctacccctccagcccggagctgcagccct
tcatcatgggcgtccacatcatcgacagggatcacggaattctctccctgcaggacgccc
ccgctccgggcccggcccttcccagggtgaatcccaacgtttccccggcaccgggaacgg
cgcccaacgggaatttcgggaatgcgccgggatccaccgttgccttaagccaaacccccg
ccaattcccaccccctgtcccacggcagccccgggatggcgccgccgccgttcccgtcgc
cgcggcaccgcggcagcccggcgtccatcccgcggtgccgcgctcccgccgggaattcct
tccctccgtccgcgctctccccgtcctcatccggcaattcccgacctttccccggcgccg
atcctccggccaatccggcgttcctgaggcaaaactctcccggtcgcgccggcaaaaccg
aactgaaggactccaaggaaatctcaaccgtgttgggtgaggtcatccatgagaacgaga
aaacgccggagacgggaattccgggaattccgggcggttccgacggcggcgtcggtgaca
ccgggaagtgcccgcaaggcacgagccaccgtttggtgcagctgctggccagcacggccg
aggcgcagctgcggcaccgcgccgacgccgccgacgccgccgcctccaaggattccctgg
cgtgcgccggcgttcccggcggttccgtcggcgcggcgccggcgccgtgcccggcctcgc
acggctcgctgaacgagcggcacaaaatcctgcaccggctgctgcaggagggcggcccct
gcgacggcgccgaggagaagagggagaacctcgccgggagcggcgccgaggccgacaaga
tgaaggaatccaaggatcaccaactgctccggtacctcctggacaaggacgagaacggaa
acgccggcggcgatcccaacaacgatcccggcgggggattccgacaacgat

DBGET integrated database retrieval system