KEGG   Taeniopygia guttata (zebra finch): 100227387Help
Entry
100227387         CDS       T01082                                 

Gene name
KAT2B
Definition
(RefSeq) K(lysine) acetyltransferase 2B
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100227387 (KAT2B)
Enzymes [BR:tgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100227387 (KAT2B)
Transcription machinery [BR:tgu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100227387 (KAT2B)
Chromosome [BR:tgu03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100227387 (KAT2B)
   HAT complexes
    PCAF complex
     100227387 (KAT2B)
    STAGA complex
     100227387 (KAT2B)
    TFTC complex
     100227387 (KAT2B)
    SAGA complex
     100227387 (KAT2B)
    SLIK complex
     100227387 (KAT2B)
    ADA-HAT complex
     100227387 (KAT2B)
    HAT-A2 complex
     100227387 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 742 aa AA seqDB search
MALIDIPLLRFQAEESCKCNGWKNPNPPPTPPRAELQQAAASLAEPCRSCSHALAAHVSH
LENVSEEEMNRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKCILQMGKPVVEGS
LESPPFEKPSIEQGVNNFVQYKFSHLPSKERQTIVELAKMFLNRINYWHLETPSQRRLRS
PNDDIAGYKVNYTRWLCYCNVPQFCDSLPRYETTQVFGRTLLRSVFTVMRRQLLEQARQE
KDKLPQEKRTLILTHFPKFLSMLEEEVYSQNSPIWDQDFMVSSSRTGQLGIQTVISPPPV
ARSIAYSASPSSLEQSNSGNMSPACKVSSALDPNLGEKRKNNEPYSLEDSKRPRVVGDIP
IELINEVMSTITDPAAMLGPETNFLSAHSARDEAARLEERRGVIEFHVVGNSLNQKPNKK
IMMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTE
IVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILNFLTYADEYAIGYFKKQGFSKDIKVPK
AKYVGYIKDYEGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSC
FKDGVRQIPIESIPGIRETGWKPSGKERGKEAKDPDQLYSTLKTILQQVKSHQSAWPFME
PVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCREYNPPESEYY
KCANILEKFFYTKIKEAGLIDK
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgatcgatatccctctgcttcgatttcaggccgaggaatcctgtaaatgcaat
ggctggaagaacccgaacccgcctcccacgccgccacgggccgagctgcagcaggcggcg
gccagcctggccgagccctgccgcagctgcagccacgcactggctgctcatgtttctcat
ctggagaatgtgtctgaagaagaaatgaacaggctcctggggattgtattggatgtggaa
tatctgttcacctgtgtccacaaagaagaagatgcagacaccaagcaagtttatttctac
ctgttcaaacttttgaggaagtgcattttacagatgggaaaacctgtagtagaaggatct
ttggaaagtcccccatttgagaaacctagcattgaacagggtgtgaataattttgtgcag
tacaaatttagccacttaccctcgaaggaaaggcaaacaatagtggaactggctaaaatg
tttctgaaccgcattaactactggcacctggagacaccttctcagagaagactacgatca
cccaatgatgatattgcagggtataaagtgaattataccaggtggctttgttactgcaat
gtccctcagttttgtgacagtctacctcggtatgaaaccacccaggtttttggcaggacc
ttgcttcgctctgtttttactgtaatgagacgtcagctgctggagcaggccaggcaagaa
aaagacaaacttcctcaagaaaaacgaacactaatcctcactcattttccaaagtttctg
tctatgctggaagaagaagtatacagccagaattctcccatttgggatcaggatttcatg
gtgtccagttcccgaactggccagctgggaatccagacagttatcagtccacctcctgtt
gcaagatctattgcatacagtgcaagtccttcatctctggagcaatccaacagtggtaat
atgagtccagcttgtaaagtttcttctgcccttgacccaaacttaggggaaaagagaaaa
aataatgaaccatattcactggaggattcaaagagaccgagggttgtaggagatatccct
attgagttaatcaatgaagtaatgtcaacaattacagatcctgcagcaatgcttgggcca
gagaccaacttcctctcggcacactcggcccgggacgaggcagcgaggctggaggagcgc
agaggggtgattgaattccatgtagtcggcaactccctgaaccagaagcccaacaagaag
atcatgatgtggctggttggtttgcagaatgtgttctcccatcagctgcctcgaatgccg
aaggaatacatcacccgcttggtctttgatccgaaacataaaacccttgcattaataaaa
gatggtcgtgtcattggtggtatctgcttccggatgttcccctcccagggatttacggag
attgttttctgtgctgtgacttccaatgagcaagtcaagggttatgggactcacctgatg
aaccatctgaaggagtaccacatcaaacacaacattctcaactttctcacatatgcagat
gaatatgccatcggctacttcaaaaaacagggtttctccaaagatattaaagtaccaaaa
gcaaaatatgttggctacatcaaggattatgagggtgccacattaatgggatgtgaatta
aatccaagaatcccctacacagaattttctgtcatcatcaaaaagcaaaaagagataatt
aaaaagctcatagaaaggaagcaagctcaaatacgaaaagtttatcctggcctttcttgc
ttcaaagatggagtacggcagattcctatagaaagcattcctggaattagagagactggc
tggaaaccaagtggaaaagaaagaggtaaggaggccaaggatccagatcaactttacagc
acattgaaaaccatcctgcagcaagtgaagagccatcaaagcgcttggcccttcatggaa
cctgtgaagagaacagaagctcctggatattatgaagttataaggtttcccatggatctc
aaaacaatgagtgagcgactcaagaacaggtactacgtgtctaagaaattattcatggca
gacttacagcgagtctttacaaactgcagagagtacaacccccccgagagtgaatactac
aaatgtgccaatatactggagaaattcttctacacaaaaattaaagaagctggattaatt
gacaagtga

DBGET integrated database retrieval system