KEGG   Taeniopygia guttata (zebra finch): 100227395Help
Entry
100227395         CDS       T01082                                 

Gene name
CREBBP
Definition
CREB binding protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Melanogenesis
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100227395 (CREBBP)
   04330 Notch signaling pathway
    100227395 (CREBBP)
   04350 TGF-beta signaling pathway
    100227395 (CREBBP)
   04630 Jak-STAT signaling pathway
    100227395 (CREBBP)
   04068 FoxO signaling pathway
    100227395 (CREBBP)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100227395 (CREBBP)
  Cell communication
   04520 Adherens junction
    100227395 (CREBBP)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    100227395 (CREBBP)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100227395 (CREBBP)
   05168 Herpes simplex infection
    100227395 (CREBBP)
Enzymes [BR:tgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100227395 (CREBBP)
Transcription factors [BR:tgu03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    100227395 (CREBBP)
Mitochondrial biogenesis [BR:tgu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100227395 (CREBBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
14
AA seq 2361 aa AA seqDB search
MAENLLDGPPNPKRAKLNSPGFSASDSTDFGSLFDLENDLPDELIPNGELGLLNSSGNLV
PDAASKHKQLSELLRGSSGSSLNPGIGNVNSSSPVQQGVGAQVQGQPNSANIGNLGAMGK
SPLNPGDSSAPGLAKQAASTSGPTTPASQTLNSQAQKQVGMVTSSPATSQTGPGICMNTN
FSQTHQSLLNSNSGHSLMNQPQQGQGQVMNGSLGAAGRGRGAGMQYSAPAMQGNAGSVLA
ETLTQVSPQMAGHTGLNAAQTGAITKLGMTGNTTPFGQPFSQTGGQQMGAAGVNPQLPNK
PGMANSLSPFPADIKSTPVTSVPNMSQMQTQVQQVGIVPTQAMATGPTADPEKRKLIQQQ
LVLLLHAHKCQRREQANGEVRACALPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIIS
HWKNCTRHDCPVCLPLKNASDKRNQQPLLGSPAGGIQNSIGSVGTGQQNTPSLSNPNPID
PSSMQRAYAALGLPYGNQPQTQLQPQVQGQQPAQPQAHQQMRTINALGANQMNLPTGGIT
TDQQPGLISETALPTSLGTNNPLMNDGTNSGNVGNLSSMPTAAPPSSTGVRKAWHEHVTQ
DLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANSRDEYYHLLAEKI
YKIQKELEEKRRSRLHKQGMLGNQAALQTPGPQPPGIPQVAAAMGQAQPVRPPNGPMSMP
TVPISRMQVSQGMNQFNPMSIGNVQMPQAPLGPRAASPMNHPVQMNSMGAVPAMAMSPSR
MPQPQNMMGAHSNNMMGQAPTQNQFLPQNQFPASTGAMNVNNVGMGQSTAQAGVAQGQVP
SAALPNSMNMLGPQSGQLPCPPVTQPPLHQTTPPVSSAAGMPPLQHPTPPGMTPPQPAAP
TQPSTPVSSSGQTPTPTPGSVPTATQTQSTPTGQTAAQAQVTPQPQTPAQPQSVPTPQPA
QQQPTSVQAQPPGTPLSQAAASIDNRVPTPASVASADTNSQQLGPDAPMLESKSEVKTEE
TEPETSETQVEAKTEVEEDLQGSSQIKEETDGTELKQEPMEIEEKKPEIKTEVKEEEESG
TNGTTSQSTSPSQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYF
DIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCTKLAEVFE
QEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQG
ENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGF
VCDNCLKKTGRTRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSD
KTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNT
RRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHC
HPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWP
NVLEESIKELEQEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKK
KPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVINTLHPIVDPDPLLSCDLMDGRDA
FLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDY
DLCINCYNTKSHDHKMVKWGLGLDDESNNQGEQQSKSPQESRRLSIQRCIQSLVHACQCR
NANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNI
KHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSATPGTPTQQPSTPQTPQPA
PQPQPSPVSMSPAGFPSVSRTQPPTTVSTGKPANPVSAPPPPAQPPPGAREAARQIEREA
AQQQQQQLYRVNNMNNGLPPGRPGLVNPAGGLGDQMPHQLMAAFIKQRTAKYVANQPGMQ
PQAGIQPQPGMQQPQTGMQQPGMHAQAGLQNMNAMQAGVQRPSVPPQQQGIGAMNPQGQA
INIMNPSHNPSMANMSPQYREILRRQLLQQQQQQQQQGGASMAGGMAAHNQFQQPQGPGG
YPQAMQQQRMQQHLSIQGSSMGQMAQMGQLNQMGQPGLGADGAPNIQQALQQRILQQQQM
KQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQIATSLSNQVRSPAPVQSPRPQSQPPHS
SPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSMDQGHLGNPEQSAMLPQLNTPNRSALS
NELSLVGDTTGDTLEKFVEGL
NT seq 7086 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaacttactcgacgggccgcccaaccccaagcgagccaagctcaactcgccg
ggcttctccgccagcgatagcacagatttcggatctttgtttgatttggaaaatgatctt
cctgatgagctgatccccaatggcgagttgggccttttaaatagcagtgggaacctcgtt
ccagatgcggcttccaaacacaaacaactttctgaacttctgaggggaagcagcggctct
tccttaaacccaggaattggcaatgtgaactcgagcagccccgtgcagcagggagtcggt
gctcaggtgcaagggcagccaaacagcgcgaacatcggcaatctgggtgccatgggtaag
agcccgctgaacccaggggactcctctgctccgggcctggccaagcaagcagccagcacc
tctggacctaccacacctgcatcccaaactctgaactctcaagcacaaaaacaagtggga
atggtgacgagcagccctgcaacatcgcagactggacctgggatatgtatgaatactaat
ttcagtcagacacaccagagtcttctcaacagtaattctggtcacagtttaatgaatcag
cctcagcaaggacaagggcaggtaatgaatggatctcttggggcagctggaagaggaagg
ggagcaggaatgcaatattctgcccctgccatgcaggggaatgcaggcagtgtgctggca
gagactttaacccaagtatctccacagatggctgggcacaccgggctgaacgcagcacag
acaggagcaattactaaactgggaatgacaggtaacactactccctttgggcaacctttc
agtcaaactggagggcagcagatgggagctgcaggagtgaatcctcagttgccgaacaag
ccaggcatggccaatagcctgtctcccttccctgccgacatcaagagtactcctgtcacc
agtgtgccaaacatgtcccagatgcaaacccaagtccagcaagtgggaatcgtcccgaca
caggccatggccaccgggcccacggcagaccccgagaagcgcaagctgatccagcagcag
ctggtcttgctgctccacgctcacaagtgtcagcggcgcgagcaggccaacggcgaggtg
cgcgcctgcgccctcccgcactgccgcaccatgaagaacgtcctcaaccacatgacgcac
tgccaggctggcaaggcctgccaagttgctcattgtgcatcttcgagacaaatcatctcc
cactggaagaattgtactcggcacgactgtcccgtgtgccttcctctgaaaaatgccagt
gacaaaagaaaccaacagccccttttagggtctccagctggtgggatccagaattctatc
ggttctgttggcacgggccagcagaacactccatcactgagcaatcccaacccaattgac
cccagctccatgcaacgagcctacgctgccctggggctgccatatggtaaccagccccaa
acacagctgcagccccaggtccaaggccagcagccagcacagcctcaggctcaccagcaa
atgaggaccattaatgcactgggagccaaccagatgaaccttcccacaggaggaataaca
acagaccagcaaccgggtctaatttctgaaactgctcttccaacatcccttgggacaaat
aacccactaatgaatgatggcacaaactctggcaatgttggaaacctcagctcaatgcca
acggctgcacctccttcgagtaccggggtaaggaaagcatggcatgaacatgtcactcag
gacctgcgcaatcatttagtgcataaacttgtccaagccatcttccccactcctgatcca
gcagcactgaaggatcgccgcatggagaacttggtggcttatgccaggaaagtggaagga
gatatgtatgaatctgctaatagtagggatgaatactatcatttattagcagagaaaatc
tataagatacaaaaggagctagaagagaagaggaggtctcgtctccataaacaagggatg
ctggggaaccaagcagccttacagacccccgggccccagcccccagggattccccaggtg
gctgctgccatgggccaggcacagcccgtcaggccacccaatgggcctatgtccatgcca
accgtgcctatcagtcgtatgcaggtttctcaaggaatgaatcagtttaaccccatgtcc
atagggaatgtacagatgccccaagcaccgctgggcccgcgggcggcgtctccgatgaac
cacccggtgcagatgaacagcatgggcgccgtgcccgcgatggcaatgtctccttcccga
atgcctcagccacagaacatgatgggagctcattccaacaacatgatgggtcaggctcct
acccagaaccaattcttgccccaaaaccagttcccagcatccactggagctatgaatgtg
aacaatgtgggcatgggacagtcaacagcccaggccggggtggcacaggggcaggttccc
agtgctgctcttcccaactccatgaacatgctgggaccgcagagcgggcagctgccgtgt
cccccggtgacgcagccccccctgcaccagaccacacctcccgtgtcctctgctgccggg
atgccaccgctgcagcacccgactcccccgggaatgactcctccccagccagcagcaccc
acccagccatcgacaccggtctcgtcctcgggacaaactccgaccccgacgccgggctct
gttcccacggccacgcagacccagagcacccccacggggcagactgcggcccaggcccag
gtgacaccgcagccacagacccctgcccagccccagtctgtgccaaccccacagccagcc
cagcagcagccaacatctgtgcaggcgcagccacccggcactccactatcccaggcagca
gctagtattgataacagggtccccacccctgcctcagttgctagtgctgatacgaattcc
cagcaactaggaccagatgcaccaatgctagaaagcaaatcagaagttaaaactgaagaa
actgagccagagactagtgagacacaagtggaagctaagactgaggtggaggaggattta
caaggatcttcacaaataaaagaagaaacagatggaactgaactgaagcaggagccaatg
gagattgaagaaaagaagcctgaaattaaaacagaggttaaagaggaagaagagagtggc
actaatggaaccacttcacaatccacatcaccctctcagccccgcaagaaaattttcaag
cccgaggagctgcgccaggctctcatgcccaccctggaagccttgtacaggcaggaccca
gagtcccttcctttcaggcagcctgtggatccccagcttttagggattccggattatttt
gacattgtgaagaatcccatggatctgtcaaccatcaagcgcaagctggatacggggcag
taccaggagccctggcagtacgtggatgatgtgtggctgatgttcaacaacgcctggctc
tacaaccgcaagacttcccgggtctacaagttttgcactaagctggcagaggtgtttgag
caggagattgacccggtcatgcagtccctgggctactgctgcgggcgcaagtatgagttc
tctccccagaccttgtgctgctatggcaagcagctgtgtactattccccgggatgccgcc
tactacagctaccagaacaggtatcacttctgtgagaagtgtttcactgaaatccagggg
gagaatgtcaccctgggtgatgacccttcccagcctcaaacaaccatctctaaggatcag
tttgaaaagaagaaaaacgacaccctggatccggagccgtttgttgactgcaaggaatgt
ggtcggaagatgcaccagatttgtgtgttacattatgatattatttggccttcagggttt
gtctgtgataattgtctgaagaaaactggtagaacacgcaaagaaaacaaattcagtgct
aaaaggctgcagaccacacgtttggggaaccatttggaagacagagtgaacaaattcctg
cggcgtcagaaccatcctgaggctggagaggtctttgtcagagtggtagcaagttcagat
aagacagtagaagtcaaaccaggaatgaaatccagatttgtggactctggtgagatgtca
gaatccttcccttaccgtaccaaagctctgtttgcgttcgaggagatcgacggggtggac
gtgtgtttctttgggatgcacgtgcaggagtacggctcggattgcccccctcccaacacc
aggcgtgtgtacatctcctaccttgacagtattcacttcttccggccccgctgcctccgc
accgccgtgtaccacgagatcctcatcggctacctggagtacgtgaagaaactcgggtat
gtgacagggcacatctgggcctgtccccccagtgaaggagatgattacatctttcattgc
cacccacctgaccagaaaatacccaaacccaaacgtttgcaagaatggtataagaagatg
ctggacaaggcatttgctgagagaataattcatgactacaaggacatcttcaaacaagcg
actgaggacaggctgaccagtgccaaggagctgccttacttcgaaggtgatttctggcct
aatgtgctggaggaaagcattaaggagctggagcaggaggaggaggagaggaagaaggaa
gagagcactgcagctagtgaaacaacagaggggagccagggcgacagcaagaatgccaag
aaaaagaacaacaaaaaaaccaacaagaataagagcagcatcagcagagctaacaagaag
aagcccagcatgccaaacgtgtccaatgacctgtctcagaagctctacgccaccatggag
aagcataaagaggtgttttttgtgattcatttacatgccgggcctgtgattaacactttg
caccccattgtggacccggatccactgctgagctgtgacctgatggacgggcgagacgcc
ttcctcaccttggccagagataagcactgggagttctcctccctgcgccgctccaagtgg
tccacgctgtgcatgctggtggagctgcacacccaggggcaggaccgcttcgtctacacg
tgcaacgagtgcaagcaccatgtggagaccaggtggcactgcactgtctgcgaggactac
gatctctgcatcaactgctacaacactaagagccatgaccacaagatggttaagtggggc
ctgggtctggatgatgagagcaacaaccaaggagagcagcagtccaagagcccccaggag
tcgcgacggctgagcatccagcgctgcatccagtccctcgtccacgcctgccagtgccgc
aatgcaaactgctctctgccatcctgccagaagatgaaacgggttgtccagcacaccaag
ggctgcaagcgcaagaccaacggcggctgtccggtgtgcaaacagctcatagctctttgc
tgctaccatgccaaacactgccaagagaacaaatgccccgtgccattctgtctcaatatc
aaacacaagctccgacagcagcagatccagcaccgcctgcagcaggctcagctcatgcgc
agaaggatggctaccatgaacacccgaaacgtgcctcagcaaagtttgccttctcctacc
tcagcaacgcctggtacccctacgcagcagccaagtacaccgcagacaccgcagcctgct
ccccagccccagccctcccctgtaagtatgtcaccggccggctttcccagcgtgtccaga
acccagccccccaccaccgtctcgacaggaaaacccgcaaacccggtttccgcgccgccg
cctccggcccagccgccgccgggcgcccgggaagcggctcggcagatcgagagagaggct
gcgcagcagcagcagcagcagctctacagggtcaacaacatgaacaatggtttgcctccc
ggccgcccgggactcgtgaaccccgcgggggggctcggtgatcagatgccgcatcaactt
atggcagcttttataaagcaaagaacagccaaatacgtggcgaaccagcctgggatgcag
ccgcaagcagggatacagccccagcccgggatgcagcagccgcagaccggcatgcaacag
ccaggcatgcacgcgcaggcgggactgcagaacatgaacgcgatgcaagccggagtgcag
agaccgagcgtccccccgcagcagcaagggatcggagctatgaacccccagggacaggcg
atcaacatcatgaaccccagccacaaccccagcatggccaacatgagcccgcagtaccgc
gagatcctgaggaggcagctcctgcagcaacagcagcagcagcagcagcagggaggggcc
agcatggcaggagggatggcagctcacaaccagttccagcagccccaaggcccgggaggt
tacccccaagccatgcagcagcaacggatgcagcagcacctatccatacaggggagttcc
atgggacagatggctcagatgggacagctgaaccagatgggccagcccggcctgggggcg
gacggcgctcccaacatccagcaggccctgcagcagcgcatcctgcagcagcagcagatg
aagcagcagatagggtcccccgggcagcccaaccccatgagcccacagcagcacatgctc
tcaggacaaccgcaggcgtctcatctccctggccagcagatcgccacctccctcagcaac
caggtgcggtccccagcgcccgttcagtctccccgtccccagtcccagccgccacattcc
agcccgtcacccaggatacagccccaaccgtcaccgcaccacgtctctccccagactggt
tccccccacccaggactcgcagtcactatggctagctccatggatcagggacacttgggc
aacccagaacagagtgcaatgcttccccaactaaacacccccaaccgcagtgcgttgtct
aacgaattgtctctggtcggtgacaccaccggggacacattagagaaatttgtggagggt
ttgtag

DBGET integrated database retrieval system