KEGG   Taeniopygia guttata (zebra finch): 100227504Help
Entry
100227504         CDS       T01082                                 

Gene name
PLCD4
Definition
(RefSeq) phospholipase C, delta 4
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100227504 (PLCD4)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100227504 (PLCD4)
   04070 Phosphatidylinositol signaling system
    100227504 (PLCD4)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100227504 (PLCD4)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100227504 (PLCD4)
Membrane trafficking [BR:tgu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100227504 (PLCD4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100227504 (PLCD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 702 aa AA seqDB search
MASLLCNARIQLTDTLEQMQQGTLMRKVKSKSWKKQRYFKLQEDCMTIWYQSKRTGKTES
AFSISDVETVREGHQSEVLQSVAEEFPPERCFTIVFYGRRGNLDLVAGSAEEAQCWVQGL
RQLIEVATTMDQREKIDQWIRDWFQKADKDKDGRMNFKEVQRLLKMMNVDMNEDHALRLF
QDADKSESGTLEGEEFVLFYKALTQREEVLSLFREYSEDGKKLTLLELVDFLREEQLEDE
GTEELAMELIDKYEPSETARARHVLSVDGFLMYLCSPEGSIFNPQHRGLWQDMSQPLCHY
FISSSHNTYLIEDQIRGHSSIEGYIRALKRGCRCLEVDCWDGPNGEPMVYHGHTFTSKIP
FREVVSXLGKYVFQELKHKILLKGKKIGRLEDTLDGPGDEVPEVSDDDNGAEAEEERRRA
KKDKETLAQALSDCVIYCKNVPFRGFQEARSHSRPSEISSLSEAKARKLIRDEGNEFVRH
NAWQLTRIYPSGMRTDSSNYSPQEMWNVGCQIVALNFQTAGMEMDLCDGLFSQNGHCGYV
LKPPFMRDKETLFNPSDPRSWEGPGPITLTIQVISGQQLPKVANSKEGAIIDPLVRVEIY
GVPADQAHQETKYIENNGFNPCWDETLQFQLHVPELALVRFVVEDYDKTSRNDFVGQFTL
AFANIKPGYRHIHLLSKDGTSIPPSSLFVHIRITEPPGPEQD
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgctgctgtgcaacgcccgcatccagctcacagacacgctggagcagatgcag
caggggactctgatgcgtaaagtcaagtccaagagctggaagaagcagcgttacttcaag
ctgcaggaagactgcatgaccatctggtaccagtccaagaggacaggcaaaactgagtct
gccttctccatcagcgatgtggagacggtgcgggaagggcaccagtcggaggtgctgcag
agtgtggctgaggagttccctcctgagcgctgcttcaccattgtcttctacggccgtcgt
ggcaacctggaccttgttgctggctcagcagaggaggcacagtgctgggtacagggccta
cgtcagctcatcgaggtggccaccaccatggaccaaagggagaagatagaccaatggatt
cgtgactggttccagaaagctgacaaggataaggatgggcgcatgaactttaaggaggtg
cagcgtctcctgaagatgatgaacgtggacatgaatgaggatcatgccctgcggcttttc
caggatgctgacaagtcagagtcggggacactggaaggggaggaatttgtactcttctac
aaggctctcacgcagcgtgaggaggtgctgagcctcttccgggaatactctgaggatgga
aagaagctgacactgctggagctcgtggatttcctgcgggaggagcagctggaggatgag
ggcacagaggagttggccatggagctcattgacaagtatgaaccatcagagacagcccgg
gcccgccatgtgctgagtgttgatgggttcctcatgtacctctgctccccggagggctcc
atcttcaacccccagcaccgggggctgtggcaggacatgagccagccactctgccactac
ttcatctcctcctcccacaacacctacctgatagaggatcagatccggggccacagcagc
atcgagggctacatcagggctctgaaacgaggctgccggtgcctggaggtggattgctgg
gacgggccaaacggggagcccatggtgtaccatggccacaccttcacctccaaaatcccc
ttccgggaggtggtgagcnacctggggaagtacgtcttccaggagctgaagcacaagatc
ttgctgaaggggaagaagattgggcggttggaggacaccctggatgggccaggggatgag
gtgcctgaggtgtctgacgatgacaatggggcagaggcagaggaggagaggcggagggca
aagaaggacaaggagaccttggcacaagcattgtctgactgtgtcatctactgcaagaat
gtgcccttccggggcttccaggaggcccgcagccattcccggccctctgagatctcctcc
ctttctgaagccaaggccaggaagctcatccgggatgaaggaaatgagtttgttcgccac
aatgcctggcagctgacacgcatctaccccagtgggatgaggactgactcctccaactac
agcccccaggagatgtggaacgtggggtgccagatcgtggccttgaacttccagacagct
ggaatggagatggacctgtgtgacggactcttcagccagaatggccactgtggctatgtg
ctcaaaccacccttcatgagggacaaggagactctcttcaaccccagtgaccccaggagc
tgggaaggccctggccccatcaccctgacaatccaggtaatcagtgggcagcagctgccc
aaagtggccaacagcaaggagggagccatcattgacccactggtgcgtgtggagatctat
ggggtccccgcggaccaggcgcaccaggagaccaagtacatcgagaacaatgggtttaac
ccctgctgggatgagacactgcagtttcagctccacgtacctgagctggccctcgttcgc
tttgtggtggaggattatgacaagacttccaggaatgactttgtgggtcagttcacccta
gcatttgccaacatcaaacctggatatcggcacatccatctcctctcaaaggatggcacc
agcatcccaccctcttcgctctttgtccacatccgcatcactgagccacctggccctgag
caggactga

DBGET integrated database retrieval system