KEGG   Taeniopygia guttata (zebra finch): 100227507Help
Entry
100227507         CDS       T01082                                 

Gene name
PDIA5
Definition
protein disulfide isomerase family A, member 5
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 681 aa AA seqDB search
MGWLGQQGKRAAALPAGVRSGGSAQPGAQGVPPRAMRAAAGSVPAHRPEKALPGVRPRLS
ERLRAGAPGCPGPGGSDRRRFGPKFRVKSGAVAKGFPCCGGAAASALCTCHRPEKALPGV
RPRLSERLRAGAPGCPGPGGSDRRRFGPKFRVKSGAVAKGFPCCGGAAASALCTCAFLPA
FVYSLKVSPLIEKITDHKDFKKLLRTRNNVLVLYSKSATAAESSLRLLSSVAQEVKGRGT
ISWIDCGDTESRKLCKKMKVDPNSKEKGVDLLHYKDGAFHTAYNRAVTLKSMVAFLKDPE
GAPLWEEDPEAKDIVHVDSEKELRRLLKKEDKPLLMMFYAPWCGVCKRMMPSYQQAATEL
KGKYVLAGMNVYSAEFERIKEEFNVRGYPTICYFEKGKFLFNFENFGATAADIAEWLKHP
QAPQPQAPETPWADEENVVYHLTDEDFDKFIKDHSSVLVMFHAPWCGHCKKMKPEYEKAA
EFLHVTSDSPGVLAAVDATVNKALAERYHISGFPTLKYFKDGEEKYTLPHLRTKKKIIDW
LQNPEAPPPPEPAWEEKQTSVIHLAGEDFRESLKKKKHTLVMFYAPWCPHCKNAIPHFTT
AAEVFKEDRKIAYAAVDCAKGQNHDLCKQEGVDGYPTFNYYNYGKFVEKYTGDRGESGFT
TFMRTLRERDHERVGKKKDEL
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgggttggctcgggcaacaagggaagcgagcggcggctctgccagccggcgtcaggagc
ggcggctctgcccagcccggcgctcagggagtgccgcctcgggccatgcgagcggcggcg
ggcagcgtccccgcgcaccgcccggagaaagcgctccccggcgtgcggccgcggctctcc
gagcggctgcgggctggggcccccggctgccccggccccgggggctccgaccggcggcgc
ttcggtcccaagtttcgtgtgaaaagcggtgcggtggcaaagggcttcccgtgctgcggc
ggagctgccgcctcggctttgtgcacctgccaccgcccggagaaagcgctccccggcgtg
cggccgcggctctccgagcggctgcgggctggggcccccggctgccccggccccgggggc
tccgaccggcggcgcttcggtcccaagtttcgtgtgaaaagcggtgcggtggcaaagggc
ttcccgtgctgcggcggagctgccgcctcggctttgtgcacctgcgcattcttgccagca
ttcgtgtactcattgaaggtatctccactcatagaaaaaataactgatcacaaggatttt
aagaagcttctcaggacacggaataatgtactagtgctctattccaaatctgccactgct
gctgaaagctcgctcagattgctgtccagtgtggcccaggaggtgaaaggacgaggtact
ataagctggatagactgtggtgatactgaaagccgaaaattatgcaagaagatgaaggta
gatcctaattcaaaggagaagggagtggatttgctacattataaggacggtgcatttcat
actgcatataacagagcggtcacattgaagtctatggtggcctttctcaaggatccagaa
ggtgctccactgtgggaggaagatcctgaagccaaagatattgtgcatgtcgacagtgaa
aaggaactgaggaggcttctgaagaaggaagacaagcccctactgatgatgttctatgcc
ccatggtgtggtgtttgtaagagaatgatgccatcttatcagcaggcagccacagaactc
aagggtaaatatgttcttgcggggatgaatgtttactctgctgaatttgaaaggataaaa
gaagaattcaatgtccggggatatcctacaatctgctattttgagaaaggaaagttcttg
ttcaactttgagaacttcggtgctaccgcagcagatatcgcagagtggctgaaacaccca
caggcacctcagccacaggctccagagactccctgggcagatgaagaaaatgtagtttat
cacctgaccgatgaggacttcgacaagtttataaaagatcattcatctgtgctagtgatg
ttccatgcaccatggtgtgggcactgtaagaagatgaaaccagaatatgagaaggctgca
gagtttctccatgtaaccagtgatagtccaggtgtccttgcagcagtcgatgctactgtc
aacaaggctcttgcagaaagatatcacatctcagggtttcctactttgaagtattttaag
gatggagaggagaaatacactctgccacacctcagaacaaagaagaagatcattgactgg
ctgcaaaatccagaagcaccacctccacctgagcctgcatgggaagaaaaacagaccagt
gttatccacctggccggagaagacttcagggagtccttgaaaaagaagaagcataccctt
gtcatgttctatgcaccatggtgtcctcactgtaaaaatgccattccacatttcacaact
gctgctgaagtctttaaagaagatcgcaagatcgcctacgctgcagtggattgtgccaaa
ggacagaatcatgacctgtgtaagcaggagggggttgatggttaccccaccttcaactat
tacaactatgggaaatttgtggaaaaatatactggagatcgaggggagtctggattcacc
actttcatgcgaaccctgagagaaagagatcatgaaagagtaggaaagaagaaggatgaa
ttgtag

DBGET integrated database retrieval system