KEGG   Taeniopygia guttata (zebra finch): 100227578Help
Entry
100227578         CDS       T01082                                 

Gene name
GBA
Definition
glucosidase, beta, acid
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100227578 (GBA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100227578 (GBA)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100227578 (GBA)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     100227578 (GBA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 491 aa AA seqDB search
CVCNATFCDTLDPLVLPASGYFVKYESSKAGKRLERSEGKFQRRLCPSDVVLTLDTTQRF
QKVKGFGGSITDAAAINILSLPEGAQDHLLRSYFSEEGLEYNLIRLPMASCDFSLHAYTY
DDVPYDYELAHFSLRDEDTKLKIPLLHRASAMSKRPLSLYASPWTSPTWLKTSESYVGKG
TLKGQAGDKYHKTWANYFVRFLDEYAKHNVTFWAVTAENEPTAGLINNYPFQCLGFTAEQ
QRDFIARDLGPALANSSHRHVQLIILDDNRLHLPHWARVVLEDEGAARYVHGIGIHWYLD
FIGPIQDTVLPTHELFPDYFILATEACIGAHFWERDVILGCWERGNQYSHSILTNLNHYV
SGGTGRAHAQWTDWNLALDLEGGPNWVKNYVDSPIIVDSSEGIFYKQPMFYHMGHFSKFI
PEGSQRVGLVASRESKKTALEYTAFLRPDGAVVVVVLNRSPQDITFGLAEPSAWWQPWLR
PTPSNLLWQRQ
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
tgcgtctgcaatgccactttctgtgacacgctggaccccctggtcctgccagcatcaggc
tacttcgtcaagtatgaaagcagcaaggccggcaagcggctggagcggagcgaggggaaa
ttccagcgcaggctctgcccctcagatgttgtcctcacgctggacacgacgcagcggttt
cagaaggtgaagggttttggtggctccatcaccgacgcggccgccatcaacatcttatcc
ctgccggaaggagcacaggatcacctgctgcgctcctacttctccgaggaggggctggag
tacaacctcatccggctccccatggccagctgcgacttctccctccatgcctacacctac
gacgacgtcccctacgactacgagctcgcccacttcagcctgcgagatgaggacaccaag
ctgaagatccccctccttcaccgagcctcggccatgagcaagcggccgctgtcgctctat
gccagcccctggacgtcccccacgtggctgaagaccagcgagtcctacgtgggcaagggg
acactgaaggggcaggcaggggacaagtaccacaagacctgggccaactattttgtacga
ttcctggatgaatacgccaagcacaatgtgacattctgggcagtgacagcagagaacgag
cccacggctgggctgatcaacaactaccccttccagtgtttgggtttcacagccgagcag
cagcgggacttcatcgctcgggacctgggcccggcgctggccaacagctcccaccgccac
gtccagctcatcatcctggacgacaaccggctccacctcccgcactgggccagagtggtg
ctggaggacgagggggcagctcgctacgtccacggcatcggcatccactggtacctggac
ttcatcggtcccatccaggacacggtgttgcccactcatgagctcttccctgactacttt
atcctggccactgaggcgtgcattggggcccatttctgggagcgggatgtgattctgggc
tgctgggagcgggggaaccagtacagccacagcatcctgacgaatctgaaccactatgtg
tccgggggaactgggagggcacatgcccaatggactgactggaatctggctctggatttg
gaggggggccctaactgggtcaagaactatgtggacagccccatcatcgtggacagcagt
gaaggcattttttacaaacagcccatgttttatcacatggggcacttcagtaaattcatc
cctgagggatcccagcgtgtggggctcgtcgcctccagagagtccaagaagacagcgctg
gagtacacggctttcctgcgccccgacggggccgtggttgtggtggttctgaaccggtcc
ccacaggacatcacctttgggctggcggaaccgtcggcctggtggcagccgtggctccgg
ccaactccatccaacctactgtggcagcggcagtga

DBGET integrated database retrieval system