KEGG   Taeniopygia guttata (zebra finch): 100227792Help
Entry
100227792         CDS       T01082                                 

Gene name
POMT2
Definition
protein-O-mannosyltransferase 2
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    100227792 (POMT2)
Enzymes [BR:tgu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     100227792 (POMT2)
Glycosyltransferases [BR:tgu01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   100227792 (POMT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 726 aa AA seqDB search
MMNSFECDIPVFNSPVNSLKFQTGTRKYGIEGSTTAWPLFNRFSFTIRFHRMREPPQVCW
DETHFGKMGSYYINRTFFFDVHPPLGKMLIGLAGYLSGYDGTFPFQKPGDRYEQHNYVGM
RGFCAFLGSCLVPFAYLTVLELSKSLPAALLTAFILIFDTGCITLSQYILLDPILMFFLM
GAVLSMVKCNSCADRPFSASWWFWLSLTGVSLAGAMGVKFVGLFVVLLVGLNTIYDLWDL
LGNLSLSLVMFGKHLLARVLCLIVLPLALYTAVFAVHFAVLNRSGPGDGFFSSAFQSQLI
GNNLHNVSIPEHLAYGSVVTMKNLRMAGGYLHSHWHLYPEGIGARQQQVTAYLHKDLNNL
WIIKKHDSDTDLSDPSGPVEFVRHGDIIRLEHKETSRNLHSHQHEAPLTRKHFQVTGYGI
NGTGDSNDFWRIEVAGRRTGELIKVLRSQVRLTHVATGCILGSSGKTLPKWGWEQVEVTC
TPYLKETPNSLWNFEDHINPKLPNISLDVLKPSFAEILLESHMVMIRGNSGLKPKDNEVT
SKPWHWPINYQGLRFSGVNETDYRVYLLGNPVIWWLNLVTIGLYLLITVATAVALKRGVQ
LTSELKELSRVVLHAGGQITLGWLLHYLPFFMMGRVLYFHHYFPAMLFSSMLTGITWDAL
LKFCAGLLSPSTTARRVYGGGFLALVLLILYSFYLFHPLSYGMIGPLASNPSSPMAGLRW
MDSWEF
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgatgaattcctttgaatgcgacattcctgtcttcaattctcctgtgaattctctgaaa
tttcagacaggaacacgaaaatatgggatagagggaagtaccacagcttggcccctcttc
aacagattcagcttcaccatccgcttccaccgcatgcgggagccgccgcaagtatgttgg
gatgaaacgcattttgggaagatgggaagttactacattaatcggaccttcttctttgat
gtccatccccctttggggaagatgctgattggacttgctggctaccttagtggatatgat
ggtacatttccgttccaaaaaccaggggatcgatatgagcagcacaactatgtagggatg
agagggttttgtgcatttcttggctcctgcctggttccttttgcctacctcacagttttg
gaactgtcaaagtcactgccagcagccttactcacggctttcatccttatttttgataca
ggctgtattacattgtcccagtatattctgctggatcccattctaatgttctttctcatg
ggagctgttctgagtatggtgaaatgtaacagctgtgcagacaggccattttctgcctcc
tggtggttctggctgagtctgactggtgtgagccttgctggagcaatgggggtaaaattt
gttggcctttttgtagtcctcttggttggcttgaacacaatctatgacctatgggacttg
ctggggaacctcagcctgtcactggtcatgtttgggaagcatttactggctcgtgtactc
tgcctcatcgtactgccgcttgccctctacacggctgtgtttgctgttcattttgcagtg
ttaaatagaagcggtcctggggatggtttcttcagttcagcatttcaatcccagctgatt
gggaacaatcttcataatgtctccattccagagcatttggcatatgggtctgtggtcaca
atgaagaaccttcggatggcagggggataccttcactcccactggcacctctatccggag
ggcatcggggctcgccagcagcaggtcactgcttacttacataaagatttgaataacctg
tggatcataaagaaacatgattcagatacagatctgtctgacccctcaggtcctgtggag
tttgtgaggcatggagatataattcgtctggaacataaagaaacttctagaaatctgcac
agtcaccaacatgaggctcccctgacaaggaagcattttcaggtcactggctatggaata
aatggaacaggagactccaatgacttctggcggattgaagtggcaggcagaaggactggg
gagctcatcaaagtcctgcggagtcaggtccggctcacccatgtggccacaggctgtata
ttgggatcttctggaaagactctgccaaaatggggctgggaacaagtagaagtcacctgc
acaccatacctgaaggagacacccaattccctttggaactttgaagatcatattaaccct
aaattgcccaatatcagcttggatgttttgaagccttcttttgcagaaattctgctagaa
tcccacatggttatgatccggggaaacagtggcctcaaaccaaaggacaatgaagtcaca
tccaaaccttggcactggcccatcaattaccagggactgcgtttttctggtgtcaatgag
acagattatcgggtttatttgcttggaaacccggtgatttggtggctaaatctggtcact
attgggttatatcttctgataacagttgccactgcagtggcactgaagagaggtgtccaa
ctgacatctgaactcaaagaactgtccagagttgtgctacatgctggagggcagatcaca
ctgggctggcttcttcattacctccctttttttatgatgggacgagttctctacttccac
cactattttcctgccatgcttttttccagcatgttgacaggaatcacctgggatgcacta
ctgaagttctgtgctgggctcttgtcacccagcactacagctagaagggtatatggaggt
ggattcctggcactggttctgctcatcctgtacagcttctacctcttccatccactgtcc
tatgggatgataggacccttggcctccaacccaagcagtcccatggcagggctccggtgg
atggattcctgggaattctag

DBGET integrated database retrieval system