KEGG   Taeniopygia guttata (zebra finch): 100227852Help
Entry
100227852         CDS       T01082                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14
  KO
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Cellular senescence
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
AGE-RAGE signaling pathway in diabetic complications
Salmonella infection
Influenza A
Module
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100227852 (MAPK14)
   04370 VEGF signaling pathway
    100227852 (MAPK14)
   04068 FoxO signaling pathway
    100227852 (MAPK14)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    100227852 (MAPK14)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100227852 (MAPK14)
   04621 NOD-like receptor signaling pathway
    100227852 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    100227852 (MAPK14)
  Endocrine system
   04912 GnRH signaling pathway
    100227852 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    100227852 (MAPK14)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100227852 (MAPK14)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100227852 (MAPK14)
  Infectious diseases
   05132 Salmonella infection
    100227852 (MAPK14)
   05164 Influenza A
    100227852 (MAPK14)
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100227852 (MAPK14)
Protein kinases [BR:tgu01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100227852 (MAPK14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
26
AA seq 360 aa AA seqDB search
MSQERPKFSGQELNKTVWEVPERYQNLSPVGSGAYGSVCSAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPAKSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGPELLKKISSESARNYIQSLSYMPKMNFENVFIGANPLAVDLLEKMLVLDTDKRITAA
EALAHAYFAQYHDPDDEPVADPYDQSFESRELEIEEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggagcggcccaagttctccgggcaggagctgaacaagacggtgtgggaggtg
cccgagcgctaccagaacctctccccggtcggctccggggcctacggctcggtgtgttct
gcctttgacacaaaaactggtttgagagtggcagtgaagaagctgtcccggcccttccag
tccatcatccacgccaagagaacctaccgggagctgcggctgctcaagcacatgaagcat
gaaaatgtgattggcttattggacgtgttcacccctgccaaatcactagaagaattcaat
gatgtgtacttggtgacacatctcatgggagcagacctgaacaacattgtgaaatgccag
aagctcactgatgaccacgtgcagtttctcatttaccagatccttcgaggcctgaagtac
atccattcagctgacataatacacagggatttaaaacccagtaacctagctgttaatgaa
gactgtgagctgaagatcctggatttcgggctggcccggcacacggatgatgagatgacc
gggtacgtggccacccggtggtacagggctcctgaaatcatgctgaactggatgcactac
aaccagacagttgatatttggtcagtgggatgcattatggctgagctgttgactggaaga
acgttgttccctggcacagaccatattgatcagttgaagctcattttgagactcgttgga
accccagggcctgagcttttgaagaaaatctcctcagagtctgcaagaaactacatccag
tctttgtcttacatgccgaaaatgaattttgaaaacgtgtttattggtgccaatcccctg
gccgtggacttgctggagaagatgctggtcctggacacggacaaacgcatcacggccgcc
gaggcgctggcccacgcctacttcgcccagtaccacgaccctgacgatgaacccgtggca
gacccctatgaccagtcctttgaaagcagagaacttgagattgaagaatggaaaagcctg
acttatgatgaagtaatcagctttgtgccacccccgcttgaccaagaggagatggagtcc
tga

DBGET integrated database retrieval system