KEGG   Taeniopygia guttata (zebra finch): 100227944Help
Entry
100227944         CDS       T01082                                 

Gene name
DYRK4
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1A
AA seq 598 aa AA seqDB search
MLTEIVDKSSHVDAFSQSQLTVQERDHLGSNRVFHQRVSRGVLALPHLEGQVKHGLAADT
ANPPPFESSLPQRANKSLQSVLPSFQENGTQSKFPQFNLPDSLPEGDTRVHTKPSELEST
SIGVKLPMTASEALKNFRNQLTVYEQKEIFNYTELWFLGLEAKKIEGLPETQNNNCYDDE
HGSYLKVLHDHIAYRYEVLEVIGKGSFGQVAKCLDHKTNELVALKIIRNKKRFHSQALVE
VKILDALLKKDKDDTHNIIHMKEYFYFRNHFCISFELLGINLYELIKKNNFQGFSLSLIR
HFTLCVLRCLQVLYQERIIHCDLKPENILLYHNGQGSVKVIDFGSSCYEDQRVYTYVQSR
FYRSPEVILGHPYAMAVDMWSLGCIIAELYTGYPLFPGENEADQLACIMEVLGLPPADFI
QAASRRRTFFDSKGFPKSVTNSKGKKRCPDSKDLSTVLNTHDAGFLDFLKGCLMWEPSLR
MTPDEAMKHEWIQEPKIFRKTQAPRKMSDGSFSAFSENRRETIQNLWKNAADRVRSELAD
RLTPFTGTAESDVQNTRKHAIPEKYLENHLEKPIKYDQAEDSGERALPKTSLFFPPIK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgctgacagaaatagttgacaagtcttcccacgtggatgctttttctcagtctcagctg
actgttcaagagagggatcatctgggctctaacagagtcttccatcagagagtcagtcgt
ggtgtccttgccctcccacatctggaaggtcaagtgaagcatggtctggctgcagacact
gcaaaccctcccccctttgagagcagcctgcctcaaagagcaaataagagcttgcagagt
gtcctcccctcttttcaggaaaatggaactcaaagcaaatttcctcaatttaaccttcca
gacagtcttcctgagggtgataccagagtacatacaaaaccatccgaactggagagcacc
agcattggggtcaaactgcctatgacagcttcagaagccttgaaaaattttagaaaccag
ttaacagtctatgagcaaaaagaaattttcaattatacagagctctggtttcttggcctg
gaagctaaaaagattgaaggtttgcctgaaacccagaataataattgttatgatgatgag
catggttcctacttaaaggttttgcacgaccacattgcctaccgctacgaagtcttggag
gtcattgggaaagggtcatttgggcaggtggccaaatgcctggatcacaaaaccaatgag
ttagtggcattgaaaataataagaaataagaaaagatttcacagccaggctttggtagaa
gtgaagatccttgatgctctgctgaagaaggacaaagatgacacacacaatatcatccac
atgaaggaatacttctactttcgcaatcacttctgtatctcctttgaactgctagggata
aatttgtatgagctgatcaaaaagaacaatttccaaggcttcagcctgtcgttgattcgc
cacttcactctgtgtgtgctgaggtgcttacaagtgctctaccaggaaagaatcattcac
tgtgatctgaagcctgagaacatactattataccacaatgggcaaggttcagtcaaagtt
attgattttggatcaagctgctatgaagaccaaagagtgtacacctatgttcagagccgc
ttttatcgctcccctgaagtgattcttggtcatccttacgctatggctgttgatatgtgg
agcttaggctgtatcatagcagagctttacacaggctacccactgttcccaggggaaaat
gaagctgaccaacttgcctgcatcatggaggtattgggtcttccaccagctgattttatc
caggctgcatcaaggaggagaacattctttgattccaaaggttttcctaaatcagtaact
aacagcaaggggaaaaagagatgcccagactccaaggatctaagcacagtgctgaacacc
catgatgctggcttcttggactttttaaaaggatgcttaatgtgggagccttccctgcgc
atgactcccgatgaagcgatgaaacatgagtggatccaggagccaaaaatcttccggaaa
acacaggccccaaggaagatgagtgatggctcattctctgcattctctgaaaatagaaga
gagactattcagaacctctggaagaatgcagctgacagagtgagaagtgaactggctgac
agactgactcctttcacaggcacagcagaaagtgatgtgcagaacacaagaaagcatgcg
attccagagaaatatttggaaaaccacctggaaaagcctattaaatatgatcaagcagaa
gacagtggtgaaagagctcttccaaaaacttctctctttttcccaccaattaagtaa

DBGET integrated database retrieval system