KEGG   Taeniopygia guttata (zebra finch): 100227981Help
Entry
100227981         CDS       T01082                                 

Gene name
CASP9
Definition
caspase 9, apoptosis-related cysteine peptidase
Orthology
K04399  
caspase 9 [EC:3.4.22.62]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
p53 signaling pathway
Apoptosis
VEGF signaling pathway
Influenza A
Class
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:tgu04370]
Cellular Processes; Cell growth and death; Apoptosis [PATH:tgu04210]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:tgu04115]
Human Diseases; Infectious diseases; Influenza A [PATH:tgu05164]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
21
AA seq 420 aa AA seqDB search
MEERQRRALRRGRARLVAALRVEPLWEPLEQRGLFTRPMLEELQSAGSRGEQARQLIIDL
ETRGKQAFPAFLSILRDTGQGHLAEMLMQECESRPVPPQLPDLRPVELELQEANQRKDVI
PHERLSIPVQAESERPRMPPVPARGSAVDKRSRDQDYEMKADPCGHCLILNNVNFCRDSG
LSTREGSDIDCEKLERRFKALCFTVLTRRDLKAQEMVLELLKLSRQDHSALDCCIVVILS
HGCQTSHIQFPGGVYGTDGKPIPIEKIVNYFNGSSCPSLRGKPKLFFIQACGGEQRDQGF
VVDCDSPKEEALGDSLESDAIPFRVPSDNVDEPDAIASLPTPSDILVSYSTFPGFVSWRE
KSSGSWYVETLDSVLEQYAHSEDLLSMLVRVAHAVSARGRYKQIPGCFNFLRKKFFFVCR
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggaggagcggcagcggcgggcgctgcggcgcgggcgggcccggctggtggcggcgctg
cgggtggagccgctctgggagccgctggagcagcgcgggctcttcacccggcccatgctg
gaggagctgcagagtgctggcagccgaggagagcaagcccggcagctgatcattgacctg
gagacccgggggaagcaggctttccctgccttcctctccatcctgcgggacaccgggcag
ggccacctcgccgagatgctgatgcaggagtgcgaatcccggccggtgccaccgcagctg
ccggacctgcggcccgtggagctggagctgcaggaggcaaaccagcgtaaagatgtgatc
cctcatgaacgtttgtctatcccagtccaagccgagagtgaaagacctcgaatgcctcct
gtgccagcccgaggttcagctgttgacaagaggagccgtgatcaggattatgagatgaaa
gcggatccctgtggacattgcctgatcctcaataacgtcaatttctgcagagactcgggt
ctgtccacccgagaaggctccgacattgactgtgagaagctggagaggcgcttcaaggcc
ttgtgcttcaccgtcctgacccggcgggatctgaaagctcaggaaatggtgttagagctg
ctgaagctgtcacggcaggaccacagtgctttggactgctgcattgtggtcatcctttcc
catggctgtcagacgagtcatattcagtttcctggaggcgtttacggaacggacggaaaa
cccattcccatagaaaagattgtgaactatttcaatgggtccagttgcccgagtttgaga
ggaaaacccaaactgttcttcatccaggcctgtggtggagaacaaagggatcaaggcttt
gtagtggactgtgattcacctaaagaggaagctcttggcgattccttggaatcagacgca
atcccgtttcgggttccgtcggataacgtggatgagcctgatgccattgccagtttgccc
acacctagcgacatcttggtttcctactcaacttttccaggttttgtctcctggagggag
aagtcaagtggctcgtggtatgtggaaacgctggacagtgtgctggagcaatatgcccat
tcagaagatctgctcagcatgttagtgagggtggcacatgctgtctctgccagggggagg
tacaagcagatcccgggatgctttaatttcctccgtaaaaaattcttctttgtgtgccgc
tga

DBGET integrated database retrieval system