KEGG   Taeniopygia guttata (zebra finch): 100227981Help
Entry
100227981         CDS       T01082                                 

Gene name
CASP9
Definition
caspase 9, apoptosis-related cysteine peptidase
Orthology
K04399  
caspase 9 [EC:3.4.22.62]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
p53 signaling pathway
Apoptosis
VEGF signaling pathway
Influenza A
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    100227981 (CASP9)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100227981 (CASP9)
   04115 p53 signaling pathway
    100227981 (CASP9)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100227981 (CASP9)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     100227981 (CASP9)
Protein phosphatases and associated proteins [BR:tgu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100227981 (CASP9)
Peptidases [BR:tgu01002]
 Cysteine Peptidases
  Family C14: caspase family
   100227981 (CASP9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
21
AA seq 420 aa AA seqDB search
MEERQRRALRRGRARLVAALRVEPLWEPLEQRGLFTRPMLEELQSAGSRGEQARQLIIDL
ETRGKQAFPAFLSILRDTGQGHLAEMLMQECESRPVPPQLPDLRPVELELQEANQRKDVI
PHERLSIPVQAESERPRMPPVPARGSAVDKRSRDQDYEMKADPCGHCLILNNVNFCRDSG
LSTREGSDIDCEKLERRFKALCFTVLTRRDLKAQEMVLELLKLSRQDHSALDCCIVVILS
HGCQTSHIQFPGGVYGTDGKPIPIEKIVNYFNGSSCPSLRGKPKLFFIQACGGEQRDQGF
VVDCDSPKEEALGDSLESDAIPFRVPSDNVDEPDAIASLPTPSDILVSYSTFPGFVSWRE
KSSGSWYVETLDSVLEQYAHSEDLLSMLVRVAHAVSARGRYKQIPGCFNFLRKKFFFVCR
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggaggagcggcagcggcgggcgctgcggcgcgggcgggcccggctggtggcggcgctg
cgggtggagccgctctgggagccgctggagcagcgcgggctcttcacccggcccatgctg
gaggagctgcagagtgctggcagccgaggagagcaagcccggcagctgatcattgacctg
gagacccgggggaagcaggctttccctgccttcctctccatcctgcgggacaccgggcag
ggccacctcgccgagatgctgatgcaggagtgcgaatcccggccggtgccaccgcagctg
ccggacctgcggcccgtggagctggagctgcaggaggcaaaccagcgtaaagatgtgatc
cctcatgaacgtttgtctatcccagtccaagccgagagtgaaagacctcgaatgcctcct
gtgccagcccgaggttcagctgttgacaagaggagccgtgatcaggattatgagatgaaa
gcggatccctgtggacattgcctgatcctcaataacgtcaatttctgcagagactcgggt
ctgtccacccgagaaggctccgacattgactgtgagaagctggagaggcgcttcaaggcc
ttgtgcttcaccgtcctgacccggcgggatctgaaagctcaggaaatggtgttagagctg
ctgaagctgtcacggcaggaccacagtgctttggactgctgcattgtggtcatcctttcc
catggctgtcagacgagtcatattcagtttcctggaggcgtttacggaacggacggaaaa
cccattcccatagaaaagattgtgaactatttcaatgggtccagttgcccgagtttgaga
ggaaaacccaaactgttcttcatccaggcctgtggtggagaacaaagggatcaaggcttt
gtagtggactgtgattcacctaaagaggaagctcttggcgattccttggaatcagacgca
atcccgtttcgggttccgtcggataacgtggatgagcctgatgccattgccagtttgccc
acacctagcgacatcttggtttcctactcaacttttccaggttttgtctcctggagggag
aagtcaagtggctcgtggtatgtggaaacgctggacagtgtgctggagcaatatgcccat
tcagaagatctgctcagcatgttagtgagggtggcacatgctgtctctgccagggggagg
tacaagcagatcccgggatgctttaatttcctccgtaaaaaattcttctttgtgtgccgc
tga

DBGET integrated database retrieval system