KEGG   Taeniopygia guttata (zebra finch): 100227993Help
Entry
100227993         CDS       T01082                                 

Gene name
MAPK12
Definition
mitogen-activated protein kinase 12
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Salmonella infection
Influenza A
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100227993 (MAPK12)
   04370 VEGF signaling pathway
    100227993 (MAPK12)
   04068 FoxO signaling pathway
    100227993 (MAPK12)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100227993 (MAPK12)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100227993 (MAPK12)
   04621 NOD-like receptor signaling pathway
    100227993 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    100227993 (MAPK12)
  Endocrine system
   04912 GnRH signaling pathway
    100227993 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    100227993 (MAPK12)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100227993 (MAPK12)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100227993 (MAPK12)
   05164 Influenza A
    100227993 (MAPK12)
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100227993 (MAPK12)
Protein kinases [BR:tgu01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100227993 (MAPK12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1A
AA seq 419 aa AA seqDB search
MAPHRNLSTKAKQARREEAPWRGRAGREGFGPHCKGSHGQREPRHLPACAGSLRRRRDAA
PCAPRGAQPQAAGQGGGRALRAVRIQRRSRGSCSGGRSAVDGRSGTKVAIKKLYRPFQSE
LFAKRAYRELRLLKHMKHENVIGILDVFTPDVTLEKFNDFYLVMPFMGTDLSKIMKHEKL
TEDRIQFLVYQMLKGLKYIHSSGIIHRDLKPGNLAVNEDCELKILDFGLARHTDSEMTGY
VVTRWYRAPEVILNWMHYTQTVDIWSVGCIMAEMITGRPLFKGNDHLDQLTEIMKITGTP
TQDFVQKLHSQDAKNYIKSLPKVQKKDFASVLKYANPLAVNLLEKMLVLDAEKRVTAAEA
LMHPYFEPIHDPEEEIEAEKYDDTFDNMDLPLDEWKRITYKEILNFKPPQTLDSKETAV
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcacctcaccggaacctgagtacaaaggcaaaacaggccaggcgtgaggaggccccg
tggcggggaagagccggccgggaggggtttggtccgcactgcaagggctcgcacgggcag
cgagagccccggcacctgcctgcgtgtgcgggctcgctccgccgccgccgggacgccgcg
ccctgcgcgccccgcggagcgcagccccaggccgccgggcaggggggaggcagggcgctg
cgggcggtgcggatccagcgccggtcccgggggagctgcagcggtggtcgctcagccgtc
gatggaagaagtggtaccaaagtggctattaagaaattgtaccgcccgtttcagtctgaa
ctctttgccaaacgagcttaccgagaactgcgtctcctgaaacacatgaaacatgaaaac
gtcattggaattttggatgtgttcacaccagatgtaacactggagaagtttaatgacttc
tatcttgtcatgccatttatgggaacagacttgagtaaaataatgaagcatgagaaatta
actgaagatagaatccagttcctggtatatcagatgttgaaaggcttaaagtatattcac
tcatcaggcataattcacagggatctaaagcctggaaacctggcagtaaatgaagactgt
gaattgaagatcctggattttggattggcaaggcatacagacagtgagatgactggctat
gtggttacaaggtggtacagagccccagaggtcatacttaactggatgcattatactcag
acagttgacatctggtctgtgggctgtataatggctgagatgataacagggagacctctg
ttcaagggaaatgatcatctggaccaactcacagaaataatgaaaataacaggtacacca
actcaagattttgttcaaaaattgcacagtcaagatgcaaaaaactatatcaaaagcctc
ccgaaagtccagaagaaagattttgcatccgtcttgaagtatgcaaatcctttggctgta
aaccttttggagaagatgctggtgctggatgcagagaagcgagtcacagcagctgaggct
ttgatgcatccttactttgaaccaattcatgatcccgaggaagaaatcgaagctgagaaa
tacgacgacacctttgataacatggatcttccactagatgagtggaagcgcattacatat
aaagagattttgaacttcaagccaccacaaacattggactcaaaggagacagcagtgtaa

DBGET integrated database retrieval system