KEGG   Taeniopygia guttata (zebra finch): 100228172Help
Entry
100228172         CDS       T01082                                 

Gene name
CLTC
Definition
(RefSeq) clathrin, heavy chain (Hc)
  KO
K04646  
clathrin heavy chain
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100228172 (CLTC)
   04142 Lysosome
    100228172 (CLTC)
Exosome [BR:tgu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100228172 (CLTC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
19
AA seq 1644 aa AA seqDB search
MESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIF
NIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGC
QIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAE
ESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQSDFPVAMQISDKHD
VVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAQHEATAGIIGVNRKGQVLSVCVEE
ENIIPYITNVLQNPDLALRMAVRNNLAGAEELFARKFNALFAQGNYSEAAKVAANAPKGI
LRTPDTIRRFQSVPAQPGQTSPLLQYFGILLDQGQLNKYESLELCRPVLQQGRKQLLEKW
LKEDKLECSEELGDLVKSVDPTLALSVYLRANVPNKVIQCFAETGQVQKIVLYAKKVGYT
PDWIFLLRNVMRISPDQGQQFAQMLVQDEEPLADITQIVDVFMEYNLIQQCTAFLLDALK
NNRPSEGPLQTRLLEMNLMHAPQVADAILGNQMFTHYDRAHIAQLCEKAGLLQRALEHFT
DLYDIKRAVVHTHLLNPEWLVNYFGSLSVEDSLECLRAMLSANIRQNLQICVQVASKYHE
QLSTQSLIELFESFKSFEGLFYFLGSIVNFSQDPDVHFKYIQAACKTGQIKEVERICRES
NCYDPERVKNFLKEAKLTDQLPLIIVCDRFDFVHDLVLYLYRNNLQKYIEIYVQKVNPSR
LPVVIGGLLDVDCSEDVIKNLILVVRGQFSTDELVAEVEKRNRLKLLLPWLEARIHEGCE
EPATHNALAKIYIDSNNNPERFLRENPYYDSRVVGKYCEKRDPHLACVAYERGQCDLELI
NVCNENSLFKSLSRYLVRRKDPELWASVLLESNPYRRPLIDQVVQTALSETQDPEEVSVT
VKAFMTADLPNELIELLEKIVLDNSVFSEHRNLQNLLILTAIKADRTRVMEYINRLDNYD
APDIANIAISNELFEEAFAIFRKFDVNTSAVQVLIEHIGNLDRAYEFAERCNEPAVWSQL
AKAQLQKGMVKEAIDSYIKADDPSSYMEVVQAANASGNWEELVKYLQMARKKARESYVET
ELIFALAKTNRLAELEEFINGPNNAHIQQVGDRCYDEKMYEAAKLLYNNVSNFGRLASTL
VHLGEYQAAVDGARKANSTRTWKEVCFACVDGKEFRLAQMCGLHIVVHADELEELINYYQ
DRGYFEELITMLEAALGLERAHMGMFTELAILYSKFKPQKMREHLELFWSRVNIPKVLRA
AEQAHLWAELVFLYDKYEEYDNAIITMMNHPTDAWKEGQFKDIITKVANVELYYKAVQFY
LEFKPLLLNDLLMVLSPRLDHTRAVTFFTKVKQLPLVKPYLRSVQNHNNKSVNESLNNLF
IIEEDYQALRTSIDAYDNFDNISLAQRLEKHELIEFRRIAAYLFKGNNRWKQSVELCKKD
RLYKDAMQYASESKDTELAEELLQWFLQENKRECFGACLFTCYDLLRPDVVLETAWRHNI
MDFAMPYFIQVMKEYLTKVDKLDASESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVPP
QAPFGYGYTAPPYGQPQPGFGYSM
NT seq 4935 nt NT seq  +upstreamnt  +downstreamnt
atggagtctgacaaatttatctgcatcagagagaaagtaggagaacaggctcaagtggtg
atcatcgacatgaatgaccccagcaacccaatccggagaccaatttcagctgacagtgct
atcatgaaccctgccagtaaagtcattgcattgaaagctgggaaaacgctgcaaatcttt
aacatcgagatgaagagcaagatgaaggctcacaccatgacagatgatgtcaccttctgg
aagtggatctctctgaacactgttgccctcgtgacggataatgcagtttaccactggagc
atggagggggagtcccagcccgtgaagatgtttgatcgccactccagccttgccggctgc
cagatcatcaactacagaactgatgccaagcagaaatggctcttgctgactggaatatct
gcacagcaaaatcgtgtagtgggagcaatgcagctgtactctgtggacagaaaagtgtcc
cagcccatcgagggacatgcagccagctttgcacagttcaagatggaagggaatgctgaa
gaatccactcttttctgttttgcagtaagagggcaagctgggggtaagctgcatatcatt
gaggttggcacaccacccactgggaatcagccctttccaaagaaagctgtggatgtcttc
tttcctcctgaagcacaaagtgactttcctgttgctatgcagatcagtgacaagcacgat
gtggtgttcctcataacaaagtatggctacatccacttgtatgatctggaaactggcacc
tgtatctacatgaacaggatcagtggagagaccatttttgttactgcacagcacgaagca
acagctggaattattggagtcaacagaaagggacaagtgctctcagtgtgtgtggaagag
gagaacatcattccctacatcacgaacgtgctgcagaatcctgacctggctttacggatg
gctgtccgcaacaacctggcaggggccgaggagctctttgccaggaaattcaatgcactc
tttgcacaggggaactattcagaggcagcgaaagtggcagctaatgccccaaagggaatc
ctgcgtactccagacaccatacgccggttccagagcgttccagctcagccagggcagact
tcccctctcctgcagtattttggcattctgctggaccaagggcagctgaacaagtatgag
tcactggagctctgcagaccagtgctccagcagggccgcaagcagctcttggaaaaatgg
ttaaaagaagataaactggagtgctcagaggagctgggagaccttgtgaaatctgtggat
cctacactagcacttagtgtctatctgagagccaacgttccaaataaggtcatccagtgt
tttgctgaaacaggacaagtccagaagattgttttgtacgctaagaaggttggatatact
ccagactggatttttttgctgaggaatgtaatgagaatcagccccgatcaaggacagcag
tttgcacaaatgcttgttcaagatgaagagcctcttgcagatataacacagattgtggat
gtctttatggaatataatttaatccagcaatgtacagccttcctgctggatgcactgaag
aataatcgtccctcagaaggtcccctgcaaacacgtttacttgagatgaacctcatgcac
gcgccccaggttgcagatgccatcctgggaaaccaaatgtttactcactatgacagggct
cacatagctcagctgtgtgagaaggctggtttgctgcagagagcactggagcacttcaca
gacctgtacgacatcaagcgtgcggtagttcacactcacctcctcaaccctgagtggtta
gtgaattattttgggtccttatcagtagaagactctctggagtgtctgcgtgcgatgctg
tccgctaacatccgtcagaacctgcagatctgtgtccaggtagcttccaaataccacgaa
cagctgtcaacacagtcactcattgagctcttcgagtccttcaagagctttgaaggtttg
ttttatttcctgggttccattgtaaacttcagccaggatccagatgtgcacttcaagtac
attcaagctgcatgcaagacaggacaaattaaagaagtggaaagaatctgcagggaaagt
aactgctatgatccagaacgtgttaaaaacttcctcaaggaagctaaacttactgaccag
ctgcctctcatcattgtgtgcgaccgctttgactttgtccacgacttggtgctgtatttg
tatagaaataatctccaaaaatatattgagatttatgtacagaaggtgaatccaagccgt
ctgccagttgttattgggggactgcttgatgtggattgctctgaagatgtgatcaagaac
ctcatccttgtagtgagaggtcaattttcaactgatgaactcgttgcagaggttgagaaa
agaaacaggctgaagctgcttctgccctggctggaagcaagaattcacgagggctgtgag
gagcctgctactcacaatgcactggccaagatatacattgacagcaacaacaacccagag
agattcctgcgtgagaatccctactatgacagtcgtgttgttggcaagtactgtgagaag
agggaccctcacctggcctgcgtggcttacgagcgtggacagtgcgatctggagctgatt
aatgtgtgcaatgagaactccctcttcaagagtctctcccgctacttagttcgtcgtaag
gaccccgagctctgggccagtgtgctgctggaaagcaacccctacagaagacccctgatt
gaccaggttgtccagactgcgctgtcagagacccaggaccccgaggaagtctctgtcact
gtgaaggccttcatgactgcagatcttcccaatgagctcattgaactgctggagaaaatc
gtgctggataattcagtgttcagtgagcacaggaatctgcagaaccttctcatccttaca
gctatcaaggctgaccgcacccgtgtcatggagtacatcaatcgcctggataactatgat
gcccctgacatagccaatattgctatcagcaatgagctttttgaggaggcatttgctatc
ttcaggaagtttgatgtcaatacatcagctgtacaggtgttgatagagcacattgggaac
ctggaccgtgcgtacgagttcgccgagcgctgcaatgaacctgcagtgtggagccagctg
gccaaagcacagctccagaaggggatggtaaaggaggcaattgactcctacattaaggca
gatgatccttcctcatacatggaagttgttcaagctgctaatgccagtggaaactgggaa
gagctggtgaagtatctgcagatggcacgcaagaaggcccgggagtcgtatgtggaaaca
gaattaatctttgctcttgctaaaacaaaccgcctggcagagctagaggagttcatcaat
ggccccaacaatgcacatatccagcaggttggtgatcgctgctatgatgagaagatgtat
gaagcagccaagctcttgtacaacaacgtgtccaacttcggccgtttggcctcaaccttg
gtgcacctcggcgagtaccaggcagccgtggatggtgctcggaaagccaacagcactcgc
acgtggaaagaggtctgctttgcttgcgtggatggaaaagaattccgcctggctcagatg
tgtgggctccatattgtagtgcatgcagatgagctggaagagctaatcaactattaccag
gatcgtgggtactttgaagagctgatcactatgttggaagcagcgcttgggctggagcga
gcacacatggggatgttcacagagctggcaattctctactccaagttcaagccacagaag
atgagggagcacttggagctgttctggtccagagtcaacattcccaaggttttgagagct
gcagaacaagcccatctctgggctgaactggtgttcctgtatgataagtatgaagaatat
gataatgccataatcacaatgatgaatcacccaacagatgcttggaaagaaggccagttc
aaagatatcatcactaaggtggccaatgtggagctgtactacaaggcagttcaattctat
ttggaatttaagcctctgctgctcaatgatctgctgatggtgttgtcccctcggcttgac
cacactcgtgctgtcaccttcttcacaaaggttaaacagctgcccctggttaagccttac
ctgcgctctgttcaaaatcacaacaacaaatcagtcaatgagtccctcaacaacctcttc
attattgaagaagattaccaggctcttaggacttctatagatgcttatgacaactttgac
aacatttctcttgcccaacgtttggagaaacacgagctaatagagttccgaaggatcgct
gcctatctcttcaaaggcaacaaccgctggaaacagagcgtggagctctgtaagaaggac
aggctctacaaggatgccatgcagtacgcttccgaatccaaagatactgagctggcagaa
gagctgctgcagtggttcttgcaggagaacaagagggaatgctttggtgcttgtctcttc
acctgctacgatctcctaaggccggatgttgtcttggaaacagcgtggaggcacaacatt
atggactttgccatgccatactttattcaggtcatgaaggaatacttgaccaaggtggat
aaactggatgcatcagagtctttgagaaaggaagaggagcaagctacagaaacacaacct
attgtttatggccagccccagctgatgctgacagcgggacccagcgtggcagttcctccg
caggcacctttcggctacggctacacggcccctccatacgggcagccgcagcccggcttc
ggctacagcatgtga

DBGET integrated database retrieval system