KEGG   Taeniopygia guttata (zebra finch): 100228242Help
Entry
100228242         CDS       T01082                                 

Gene name
USP12
Definition
ubiquitin specific peptidase 12
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
tgu  Taeniopygia guttata (zebra finch)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 358 aa AA seqDB search
MPCFEGANASALEKEIGPEQFPVNEHYFGLVNFGNTCYCNSVLQALYFCRPFRDKVLAYK
SQPRKKENLLTCLADLFHSIATQKKKVGVIPPKKFITRLRKENELFDNYMQQDAHEFLNY
LLNTIADILQEERKQEKQNGRLPNGSVDSESSSPPDPTWVHEIFQGTLTNETRCLTCETV
SSKDEDFLDLSVDVEQNTSITHCLRGFSNTETLCSEYKYYCEECRSKQEAHKRMKVKKLP
MILALHLKRFKYMDQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMYDLVAVVVHCGSG
PNRGHYIAIVKSHDFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSESGYILFYQSRD
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgccatgctttgaaggcgccaatgcctcagctttggagaaagagattggtccagaacaa
tttccagtcaatgagcactattttggtttggttaattttgggaatacgtgctactgcaat
tcagttctccaggcactttatttttgtcgaccatttcgagacaaagtcttagcatacaag
agtcagccaagaaaaaaagagaacctccttacatgcttagctgatctcttccacagtata
gccacccagaagaaaaaagttggagtaatacctcccaagaaatttataacaagattacga
aaagaaaatgaactttttgataactacatgcagcaggatgcacacgagttcctaaactac
cttttgaatacgattgcggacatcttgcaagaggagaggaagcaggagaagcagaacggg
cgcctgcccaatggcagcgtggacagcgagagcagcagcccgcctgaccccacctgggtg
cacgagatctttcagggaacattgaccaacgaaaccaggtgtctgacctgtgaaactgta
agcagcaaggatgaagacttcctagacctttccgttgatgtggagcagaatacttcaatc
actcactgtttaaggggtttcagcaacacagaaactctgtgcagtgagtacaagtattac
tgtgaagagtgtcgcagtaaacaagaagctcataaaaggatgaaagtaaaaaagctgcct
atgattctagctctccatttgaagagatttaagtacatggatcagctgcatcgatacaca
aaactctcttatagagtagtttttcctttagagcttcgtttatttaacacctcaggagat
gccaccaaccctgacagaatgtatgaccttgttgctgtggtagtccattgtggaagtggc
cctaacagaggacattatattgcaatagtgaagagtcatgatttttggttgctttttgat
gatgatattgttgagaaaattgatgcacaagctattgaagaattctacgggttgacatca
gacatctcaaagaactctgagtctggttacatcctcttctatcagtctcgggactga

DBGET integrated database retrieval system