KEGG   Taeniopygia guttata (zebra finch): 100228249Help
Entry
100228249         CDS       T01082                                 

Gene name
ART4
Definition
(RefSeq) ADP-ribosyltransferase 4 (Dombrock blood group)
  KO
K06717  
ADP-ribosyltransferase 4 [EC:2.4.2.31]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100228249 (ART4)
Cellular antigens [BR:tgu04090]
 Proteins
  100228249 (ART4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
1A
AA seq 301 aa AA seqDB search
MSPPVDSLLAVKQPLSEIQPKITETFQDGELGSLNPLMDMAPHSFDDQYLGCREEMMEEL
ERGDYFQKEIAANKDYLCLWKKAQKALLKSPVGLLREMRDSHATVLMAYTMNSSLHSQLN
WATSTAGISPEHYRHNFSFKYFHFYLVTAIQILKEWQISMGEHKCYQVHRGVKDLYIEAQ
VGSRVRFGRFTSTSHLRNEAQKFGNETLFTVTTCLGAAMHGFSYHTFEKEVLIPPYEIFL
VKSFLQTQQGNRLHLHSVGNYSKYQCQLVEASRSKNSGYTALTSAVLPSVLGVSLCLTRN
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgagccctcctgtggactcacttttagcagtcaaacaaccactttctgaaatacagccc
aagataacagagacattccaggatggagaactaggtagtctgaatcccctgatggatatg
gctccgcattcctttgatgaccagtatctggggtgcagagaggagatgatggaagaactg
gagcgaggagactactttcaaaaggaaatagctgctaacaaggactacttgtgtctctgg
aagaaggctcagaaggctttgctaaagagccctgtaggtctgctgagggaaatgcgtgac
agccatgccacagtcctaatggcttacaccatgaactcctccctgcactcgcagctgaac
tgggctacatctacagcaggaatctctccagagcactacagacacaacttcagctttaaa
tattttcacttctacctagtaactgctatccagatattgaaggaatggcaaatcagcatg
ggggaacataagtgttaccaggtgcacaggggtgtaaaggacttatatatcgaggcccag
gtaggcagcagggtgcgatttggccgtttcacttctacctcccacctcaggaatgaagcc
cagaagtttgggaatgagactttgttcacagtgactacttgcctgggagcagctatgcac
ggcttttcttaccacacatttgagaaggaagtcctcattcccccttatgagatatttctt
gtcaaaagcttccttcaaacccagcagggtaaccggctgcatctgcattctgtggggaac
tacagcaagtaccagtgccagctggtggaagcttcaagaagcaagaacagtggttatact
gcactcacctctgctgttctccctagtgtgcttggagtttccctgtgcttgacccgcaat
ctctga

DBGET integrated database retrieval system