KEGG   Taeniopygia guttata (zebra finch): 100228259Help
Entry
100228259         CDS       T01082                                 

Definition
fatty acyl-CoA hydrolase precursor, medium chain-like
Orthology
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:tgu00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
11
AA seq 557 aa AA seqDB search
MAAARDTALLACVLFLGGTALGAAGKHRGEPEAETKYGRVRGYPFTVDTAERTVNVFLGL
PFAKPPLGSLRFSEPQPPEPWEGVRDATSYPPMCLQDQVQGQYFSDMITNRKEKVPLRVS
EDCLYLNVYTPVSTGKQEKLPVLVWIHGGGLLVGAASSYDGSAMAAFDNVVVVTIQYRLG
IAGYFSTGDEHARGNWGYLDQVAALRWIQENIMHFGGDPGSVTIFGESAGGISVSALVLS
PLAKGLFHKAISESGTAARGLFTDQPKEDAQKIAAASGCEKSSSAAMVECLRGKTEEELL
QITLKMDFFFISACVDGAFFPKSPKELLSEKSMNEVPYIIGVNNCEFGWVIPMMMKYPPF
VDGLDKDVARQILQSNLAKLNKGLTSEVVDRVYQEYMGHAESPAQVRDGLLDAMGDVYFV
ISAVEVARYHRDAGNPVYFYEFQHRPSSVEGVVPEFVKADHGAEIAFVFGKPFLAGGATK
EEGKLSRTVMRYWTNFAKNGNPNGEGLVHWPLYDLEEKYLGIDLEQKAAEKLKEHRMQFW
QQLMKQSQTGRIKHTDL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgcgagggacacggcgctgctggcctgcgtcctcttcctcgggggcacggcg
ctgggggccgcaggtaaacaccggggagaaccagaagcggagaccaaatatgggagagtc
cgaggctacccattcacagtggacacagctgagaggactgtaaatgtctttttgggactt
ccttttgctaagcctccgcttggatccctgaggttttctgaaccccagccaccggagcct
tgggaaggtgtcagagatgccacttcctacccaccaatgtgtctacaggaccaagtacaa
ggacagtatttttcagatatgattaccaacagaaaagagaaagttcctctgcgagtgtct
gaggattgcctgtacctaaatgtgtacacacccgtttctacaggaaaacaggagaagctg
cctgtcttagtatggatccatggaggtggattacttgttggagcagcttcatcatatgat
ggctcagcaatggcagcctttgacaacgtggtggttgtaacaattcagtacagactaggt
attgctggatattttagcactggtgatgagcatgcccgaggcaactggggatatttagac
caagtagcagctcttcggtggattcaggaaaatatcatgcattttggtggagatccagga
tctgtcaccatctttggagaatctgcaggaggaatcagtgtttctgctcttgtcttatct
cccctggccaagggcttgttccacaaggccatttcagagagtggcactgcagcccggggc
ttgttcactgaccagcctaaggaggatgcacaaaaaattgctgctgcctctggctgtgaa
aagtccagttccgctgcaatggttgaatgcttgagaggaaaaacagaagaagaactacta
cagataacactgaaaatggatttctttttcatcagtgcatgtgtagatggtgcatttttt
ccaaaaagtcccaaggaattgctatctgaaaaatcaatgaatgaggtcccatacataata
ggagtaaataactgtgaattcggatgggtaattcctatgatgatgaaatatcctcctttc
gtggatggtctggataaagatgttgcacgtcaaattttacagagcaacttggcaaaatta
aataagggccttacatctgaagttgtagacagagtgtaccaggagtacatggggcatgca
gaaagccctgctcaggtccgagatggcctcctggatgcaatgggagatgtctactttgtc
atctcagctgtggaagtggccagataccacagagatgctggcaacccagtctacttctat
gaattccaacatcgaccgagttcagtggaaggtgtggtaccagagtttgtaaaagcagat
cacggagctgagattgcctttgtctttggaaagccattcttagcaggaggtgctacaaaa
gaagaaggtaaactgagcagaactgtcatgagatactggaccaactttgctaaaaacgga
aatcccaacggagagggcttggtccattggcccctgtatgacctggaggaaaaatacctg
ggaatagacctggagcaaaaggcagcagagaaactgaaagaacatagaatgcagttttgg
caacagctcatgaaacaaagccagactggaaggataaaacacaccgatttataa

DBGET integrated database retrieval system