KEGG   Taeniopygia guttata (zebra finch): 100228259Help
Entry
100228259         CDS       T01082                                 

Definition
(RefSeq) fatty acyl-CoA hydrolase precursor, medium chain-like
  KO
K01044  carboxylesterase 1 [EC:3.1.1.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00983  Drug metabolism - other enzymes
tgu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100228259
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     100228259
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3 Peptidase_S9 Say1_Mug180
Motif
Other DBs
NCBI-GeneID: 100228259
NCBI-ProteinID: XP_012426715
Ensembl: ENSTGUG00000009626
Position
11
AA seq 553 aa AA seqDB search
MAAARDTALLACVLFLGGTALGAAGEPEAETKYGRVRGYPFTVDTAERTVNVFLGLPFAK
PPLGSLRFSEPQPPEPWEGVRDATSYPPMCLQDQVQGQYFSDMITNRKEKVPLRVSEDCL
YLNVYTPVSTGKQEKLPVLVWIHGGGLLVGAASSYDGSAMAAFDNVVVVTIQYRLGIAGY
FSTGDEHARGNWGYLDQVAALRWIQENIMHFGGDPGSVTIFGESAGGISVSALVLSPLAK
GLFHKAISESGTAARGLFTDQPKEDAQKIAAASGCEKSSSAAMVECLRGKTEEELLQITL
KMDFFFISACVDGAFFPKSPKELLSEKSMNEVPYIIGVNNCEFGWVIPMMMKYPPFVDGL
DKDVARQILQSNLAKLNKGLTSEVVDRVYQEYMGHAESPAQVRDGLLDAMGDVYFVISAV
EVARYHRDAGNPVYFYEFQHRPSSVEGVVPEFVKADHGAEIAFVFGKPFLAGGATKEEGK
LSRTVMRYWTNFAKNGNPNGEGLVHWPLYDLEEKYLGIDLEQKAAEKLKEHRMQFWQQLM
KQSQTGRIKHTDL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgcgagggacacggcgctgctggcctgcgtcctcttcctcgggggcacggcg
ctgggggccgcaggagaaccagaagcggagaccaaatatgggagagtccgaggctaccca
ttcacagtggacacagctgagaggactgtaaatgtctttttgggacttccttttgctaag
cctccgcttggatccctgaggttttctgaaccccagccaccggagccttgggaaggtgtc
agagatgccacttcctacccaccaatgtgtctacaggaccaagtacaaggacagtatttt
tcagatatgattaccaacagaaaagagaaagttcctctgcgagtgtctgaggattgcctg
tacctaaatgtgtacacacccgtttctacaggaaaacaggagaagctgcctgtcttagta
tggatccatggaggtggattacttgttggagcagcttcatcatatgatggctcagcaatg
gcagcctttgacaacgtggtggttgtaacaattcagtacagactaggtattgctggatat
tttagcactggtgatgagcatgcccgaggcaactggggatatttagaccaagtagcagct
cttcggtggattcaggaaaatatcatgcattttggtggagatccaggatctgtcaccatc
tttggagaatctgcaggaggaatcagtgtttctgctcttgtcttatctcccctggccaag
ggcttgttccacaaggccatttcagagagtggcactgcagcccggggcttgttcactgac
cagcctaaggaggatgcacaaaaaattgctgctgcctctggctgtgaaaagtccagttcc
gctgcaatggttgaatgcttgagaggaaaaacagaagaagaactactacagataacactg
aaaatggatttctttttcatcagtgcatgtgtagatggtgcattttttccaaaaagtccc
aaggaattgctatctgaaaaatcaatgaatgaggtcccatacataataggagtaaataac
tgtgaattcggatgggtaattcctatgatgatgaaatatcctcctttcgtggatggtctg
gataaagatgttgcacgtcaaattttacagagcaacttggcaaaattaaataagggcctt
acatctgaagttgtagacagagtgtaccaggagtacatggggcatgcagaaagccctgct
caggtccgagatggcctcctggatgcaatgggagatgtctactttgtcatctcagctgtg
gaagtggccagataccacagagatgctggcaacccagtctacttctatgaattccaacat
cgaccgagttcagtggaaggtgtggtaccagagtttgtaaaagcagatcacggagctgag
attgcctttgtctttggaaagccattcttagcaggaggtgctacaaaagaagaaggtaaa
ctgagcagaactgtcatgagatactggaccaactttgctaaaaacggaaatcccaacgga
gagggcttggtccattggcccctgtatgacctggaggaaaaatacctgggaatagacctg
gagcaaaaggcagcagagaaactgaaagaacatagaatgcagttttggcaacagctcatg
aaacaaagccagactggaaggataaaacacaccgatttataa

DBGET integrated database retrieval system