KEGG   Taeniopygia guttata (zebra finch): 100228504Help
Entry
100228504         CDS       T01082                                 

Definition
clathrin heavy chain 1-like
Orthology
K04646  
clathrin heavy chain
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100228504
   04142 Lysosome
    100228504
Exosome [BR:tgu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100228504
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
15
AA seq 1672 aa AA seqDB search
MAQILPIRFQEHFQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMSDPTT
PIRRPISAESAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMAEEVIFWKWISVNTVA
LVTETAVYHWSMEGESQPQKMFDRHASLAGCQIINYRTDEHQKWLLLIGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAAAFAEFKIEGNAKPSTLFCFAVRSPAGGKLHIIEVGQPATGN
QPFVKKAVDVFFPPEAQTDFPVAMQIGIKHGVIYLITKYGYIHMYDLESGVCIYMNRISA
DTIFVTAPHEPTSGIIGVNKKGQVLSVCVEEDNIVNYATNVLQNPDLGLRMAIRSNLAGA
EELFARKFNTLFAQGNYADAAKVAASAPKGILRTSDTIRKFQSVPAQPGQASPLLQYFGI
LLDQGQLNKFESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKTADPTLALSVYL
RANVPNKVIQCFAETGQFQKIVLYAKKVGYTPDWIFLLRSVMRVSPEQGLQFSQMLVQDE
EPLANINQIVDVFMEHSLLQQCTSFLLDALKNNRPAEGHLQTRLLEMNLIHAPQVADAIL
GNQMFTHYDRAHVAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHLLNPEWLVNFFGSLSV
EDSVECLRAMLSANIRQNLQLCVQVASKYHEQLGTQSLVELFESFKSYEGLFYFLGSIVN
FSQDPDVHFKYIQAACKTGQIKEVERICRESNCYNPERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRIPAVVGGLLDVDCSEDVIKNLIMVVRGQF
STDELVAEVEKRNRLKLLLPWLESRIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYY
DSRVVGKYCEKRDPHLACVAYERGQCDLELIKVCNENSLFKSEARYLVRRKDPELWANVL
EENNPFRRQLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELYEEAFAIFRKFDVNTS
AIQVLIEHIGNLDRAYEFAERCNEPAVWSQLARAQLQKDLVKEAIDSYIKADDPSAYMEV
VQAANRNDNWEDLVKFLQMARKKARESYVETELIFALAKTNRLSELEEFISGPNNAHIQQ
VGDRCYEEGMYEAAKLLYNNVSNFARLASTLVHLGEYQAAVDSGRKANSTRTWKEVCFAC
VDGKEFRLAQICGLHIVIHADELEELISYYQDRGYFEELIALLEAALGLERAHMGMFTEL
AILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMN
HPTDAWKEGQFKDIIAKVANVELYYKALQFYLDYKPLLINDLLLVLSPRLDHTRTVNFFS
KVNQLFLVKPYLRSVQNHNNKGVNEALNNLLTEEEDFQGLRASIDAYDNFDNITLAQRLE
KHELIEFRRIAAYLYKGNNRWKQSVELCKKDRLYKDAMQYAAESKDAELAEKLLQWFLEE
GKQECFAACLFTCYDLLHPDVVLELAWRHNIMDFAMPYFIQVMREYLTKVDKLDASESLR
KEEEQVTEPTPIVFGQQLMLTAGPSAVPPQANFPYGYTAPGFTQPPVYGFNM
NT seq 5019 nt NT seq  +upstreamnt  +downstreamnt
atggcccagatactgcccattcgcttccaggagcacttccagctccaaaatttgggcatt
aatccagcaaacattggattcagcaccctgacaatggaatctgacaagttcatctgcata
agggagaaagtaggggagcaggcacaagtagtgataattgacatgagtgatccaacaaca
cccatcagacgtccaatttctgcagaaagtgccatcatgaatccagcctctaaagtaata
gcactaaaagctgggaaaacacttcagatctttaacattgagatgaaaagtaaaatgaaa
gcccatacaatggcagaggaagtgatcttctggaaatggatatctgtgaatacagttgcc
ttggtgacagagacagcagtgtaccactggagcatggagggagaatcacaaccccaaaag
atgtttgatagacatgctagtcttgcaggctgccaaatcatcaattacagaacagatgaa
caccaaaaatggctgctgctgataggaatttcagcacagcaaaatcgtgtggttggtgca
atgcagctgtattcggttgatagaaaagtctcccagcctatagaaggccatgcagcagct
tttgcagaattcaaaatagagggaaatgccaaaccttctaccctcttttgttttgctgtg
aggagtcctgcaggaggcaagctgcacataattgaagtaggtcagccagctactggaaat
cagccatttgtaaagaaagctgttgatgtgtttttcccacctgaggcacagacagacttt
cctgtggcaatgcagattggaattaagcatggtgtaatttatctgatcaccaagtatgga
tatatccacatgtatgatttggagtctggagtgtgcatctacatgaaccgtattagtgct
gatactatctttgtcacagctcctcatgaacctacctcaggcattattggtgtgaacaaa
aaaggacaggtgctttctgtatgtgttgaggaagacaacattgtgaactatgctacgaat
gttctccagaatcctgacttgggactgcgaatggctatacgtagtaacctagctggggca
gaggagttatttgccagaaagttcaacacactctttgctcaaggaaactatgcagatgcc
gctaaagtagcagcatctgcaccaaagggaattttacgtaccagtgatacaattaggaag
ttccagagtgtaccagctcagcctgggcaggcctctcccttgctccagtatttcggaata
ttgctcgaccagggacagctgaacaagtttgaatctctggagctctgtcgccctgtcctg
cagcagggccgcaagcagcttctggagaagtggctgaaggaagacaagctggagtgctcg
gaggagctgggagacttggtgaagacagccgacccaacccttgcactcagtgtctatctt
cgagctaatgtgccaaacaaagtgattcagtgctttgctgaaactggccaattccagaag
atagtgctgtatgctaagaaggttggctataccccagactggatcttcctactgagaagt
gtgatgagagtcagtccagaacaaggcctgcagttctctcagatgctggtacaggatgag
gagccgctggctaacattaaccagattgtggatgtgttcatggagcacagtcttctgcag
cagtgcacatcctttttgttggatgccctgaaaaataaccgccctgcagaaggccacctt
cagacccgtctcctggaaatgaatttgattcatgccccacaggttgcagatgccattctt
ggaaaccaaatgtttacacactatgatcgtgctcatgttgcccagctgtgtgaaaaggca
ggcttactccagcgagctttggagcactacacggatctctatgatattaaacgtgcagtt
gttcatactcacctcttgaatcctgagtggcttgtgaacttctttggctctctctcagtt
gaagactctgtggagtgtttgcgcgccatgctgtcagccaacattaggcaaaacctacag
ctgtgtgtgcaagttgcttctaagtaccatgaacagcttggcacccagtctcttgtggag
ctttttgaatctttcaaaagctatgaaggactgttctatttcttgggctccattgtaaac
tttagccaggatccagacgttcacttcaagtacatccaggcagcttgcaagaccggtcag
ataaaggaagtggaaagaatctgccgtgaaagtaactgttataacccagaacgagtgaag
aacttcctgaaggaggcaaagctcacagatcagcttccgctgatcattgtctgcgatcga
tttgactttgttcatgacctggtgctctatttataccgtaataatctgcagaagtatatt
gagatctacgtacagaaggtgaatcctagccgtataccagcagtggttggagggcttctt
gatgtagattgttctgaggatgtcatcaagaacttgatcatggtggtgagagggcagttc
tccacagatgaactggtggctgaagtggaaaaaagaaatcggcttaagttgctgttgcca
tggcttgaatcaaggattcatgaaggctgtgaagaacctgcgactcataatgctttggcc
aaaatctacattgacagtaataataatccagagcgcttccttcgtgagaatccttactat
gacagccgtgtagttggcaaatattgtgaaaagagggaccctcatctggcctgcgttgct
tatgagagggggcagtgtgatctggaactcataaaggtgtgcaatgagaactccctgttt
aagagcgaggctcgctatctggtgcgcaggaaggaccctgagctctgggcaaatgtactg
gaagaaaacaacccgttcaggcggcagcttattgaccaggttgtccagacggctttatca
gagacacaggatccagaggaagtttctgtaactgtgaaagctttcatgactgctgatctc
ccaaatgaactgattgagttattggaaaaaattgtcttggataattctgtattcagtgaa
cacaggaatctgcagaatctgctgatcctgactgccattaaggctgaccgcacccgagtg
atggaatacatcaatcggctggataactatgatgccccagatattgcaaacattgccatc
agtaatgagctatatgaggaagcctttgctatattcagaaaatttgatgtcaatacttca
gcaattcaggtgctgattgagcacattggcaacttagaccgtgcttatgaatttgcagag
agatgtaatgaaccagcagtgtggagccaactggccagagcacagctccagaaggacttg
gtgaaggaagccattgactcctatataaaggcagatgatccatctgcctacatggaggtc
gttcaggcagctaacagaaatgataactgggaggacttagtcaagttcttacagatggcc
aggaagaaggctagagagtcttacgtagagacagaacttatttttgctttggcaaaaact
aatcgtctgtcagaactggaggagtttattagtggccctaataatgcccatatacagcag
gtcggtgatcgctgttatgaggagggaatgtatgaagctgcaaaacttctctataacaac
gtatccaattttgctcgcctggcatctaccttggtgcaccttggggagtatcaggcagca
gtggacagtggccgcaaagccaatagcacaaggacgtggaaggaggtctgctttgcttgt
gtggatggaaaagaattccgcttggcacagatctgtggcttacatatagtcatacatgct
gatgaacttgaggagctgattagttactatcaggatcgtggctactttgaagaactgatt
gcccttttggaagctgctttgggcctagagcgtgctcacatggggatgtttactgaactt
gccatcttatactccaaattcaagcctcagaaaatgagggaacatctggagcttttctgg
tctagagttaatattccaaaggtgctcagagctgcagaacaggctcatctctgggcagaa
cttgtattcctgtatgacaagtatgaggagtatgacaatgcaataattactatgatgaat
caccccactgatgcctggaaggaaggccagtttaaagacataattgccaaggtggccaat
gtggagctatattacaaagccttgcagttctacttagactacaaacctctgctgatcaat
gatctcctgcttgtattatctccgcgactggatcacaccaggacagtcaattttttctca
aaggttaatcagctatttctagtaaagccttacctgcgttcagttcagaaccacaacaac
aaaggagttaacgaagctctaaacaaccttttaacagaggaggaagatttccagggtttg
agagcttccattgatgcctatgacaactttgataacataacattggctcagcgtctggaa
aagcatgaactaattgaatttaggcgtattgcagcgtacttgtacaagggtaacaaccgc
tggaagcagagtgtggagctgtgcaagaaagaccgtctgtataaggatgctatgcagtat
gctgcagagtccaaagatgcagagctggctgagaagctgctccagtggttcctggaagaa
ggcaagcaggagtgctttgcagcctgccttttcacatgctatgacttgctgcacccagat
gtagtccttgagctggcatggagacataacatcatggactttgcaatgccttatttcatc
caagtgatgagagagtaccttaccaaagtggataaacttgatgcttctgaaagcctaaga
aaagaagaggaacaagtaactgaacccactccaatagtatttggccagcagttgatgtta
acagcaggccccagtgcagtacctccccaggcaaacttcccatatggatacacagcacca
ggattcacccagccgcctgtttatggtttcaatatgtaa

DBGET integrated database retrieval system