KEGG   Taeniopygia guttata (zebra finch): 100228600Help
Entry
100228600         CDS       T01082                                 

Gene name
PLA2G15
Definition
phospholipase A2, group XV
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Glycerophospholipid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100228600 (PLA2G15)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100228600 (PLA2G15)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100228600 (PLA2G15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 411 aa AA seqDB search
MRYLFSPRPPLAVPGLRGVTARTERRLRGGPGPARPGPAAGVPGDLGNQLEAKLDKPSVV
HYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSKITEPPDGVDIRVPGFGQT
FSLEFLDPSKRSVGSYFYMLVQSLVDWGYKRDEDVRGAPYDWRKAPNENKDYFVALRKMI
ELLYEQYGSPVVLIAHSMGNMYTLYFLNRQPQDWKDKYIKDYVSLGAPWGGVAKTLRVLA
SGDNNRIPVISSLKIRDQQRSAVSTNWMLPYNYTWPPDKVFVSTPTANYTLRDYWKFYRD
IDFEDGWLMRQDTEPLVYGMTPPGVRIHCLYGTGVETPDSFHYESFPDREPKIFYSDGDG
TVNLQSALQCRKWVDRQKQEVVMFELSGNEHIEMLSNYTTISYVKKLLFDL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgcgatacctcttctctccccgcccgccgctggcagtgcccgggctccgcggggtcaca
gcccgcaccgagcggcggctccgcggcggccccggcccggcccggcccggcccagcggcg
ggagttccgggcgacttgggtaatcagttggaagcgaagttagataagccatcagtggtg
cactatctctgctctaagaagacagacagttactttacactctggctgaatctagaattg
cttctgcctgtcatcattgactgttggattgataatatcaggctggtgtataatcgaaca
agtaagattacagaaccaccagatggagtggatatcagagtcccagggtttgggcagaca
ttttccttggaatttcttgacccaagcaaaaggagcgttggaagttacttttatatgttg
gtgcagagtttagtagattggggctacaaacgtgatgaagatgtaagaggagcaccttat
gactggagaaaggcaccaaatgagaataaagactattttgtggcacttcgcaagatgata
gagttactgtatgagcaatatggaagccctgttgtcctgattgcccacagtatgggcaat
atgtacaccctctacttcctgaaccgccagccccaggattggaaggacaagtacatcaag
gattatgtgtcactgggtgctccgtggggaggagtggccaaaactctccgcgtgctggct
tcaggtgacaacaacagaatccctgtcatcagttcactcaagatcagagaccagcagaga
tcagcagtttccacaaattggatgctcccctacaactacacgtggcctccagacaaggtg
tttgtgagcacacccacagctaactacacgctccgggattactggaagttctacagggac
attgactttgaggacggctggctgatgaggcaggacacggagcccctggtgtacggcatg
accccgcccggggtgcgcatccactgcctctacggcactggcgtggaaacccccgactct
ttccactatgaaagctttcctgacagagagcccaagattttctacagcgatggggatgga
acagtgaacttacagagtgccttgcaatgtagaaagtgggtggacaggcaaaaacaggaa
gtggtgatgtttgagctttcaggaaacgagcacattgaaatgctgtccaattatactact
atctcctatgtgaaaaagctgctctttgatttgtga

DBGET integrated database retrieval system