KEGG   Taeniopygia guttata (zebra finch): 100228772Help
Entry
100228772         CDS       T01082                                 

Gene name
USP4
Definition
(RefSeq) ubiquitin specific peptidase 4 (proto-oncogene)
  KO
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100228772 (USP4)
Peptidases [BR:tgu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100228772 (USP4)
Ubiquitin system [BR:tgu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100228772 (USP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 927 aa AA seqDB search
MAAAAAGAERARPDPAEQRAELGPLLATALRPGDSWRQGLRFGTRRLLGDAPGGGVCCRY
LVESRWFKQWKKYVGFDNWDMFGAGHPNLFPGPVDNAGLFPGPIDNSGLFGDPQTQSLKE
HLIDELDYVLVPTEAWNKLVAWYGCIDGQQPIVRKVVEYGLFVKHYKVEVYLLELKLCES
SDPDNVINCHFSKADTVATIEKEMRKLFSIPAEKETRLWNRYMSNTYEQLSKLDSTVQDA
GLYQGQVVLIEVKNEDGTWPGQHCLAKGSGFVCNSYNCRDSASLSQPGLCGLSNLGNTCF
MNSALQCLSNTPPLTDYFLEDKYEAEINQNNPLGMRGEIAEAYADLIKQMWSGRQSHVAP
RMFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLELKDANGRPDSEVA
KEAWENHRLRNDSIIVDIFHGLFKSTLVCPKCSKVSVTFDPFCYLTLPLPLRRDRPMEVT
LVYADPQRRPVQYRVVVPVMGAISDLCESLSKLSGVPAENMVVTDVYNHRFHKIFQMDEG
LNPIMPKDDIFVYEVCKPSEDGSEYVTLSIYFREKTMRQSSNTSGTVLFGQPLLISVPKH
KLTVDHLYSVVLEQISRCVKLPLAEEYSPPCPDRGTCNGSNGVVEGDIEEMEHQDGGEEG
KEKLTEVDPCHSEGCMQVESARDLQPCKKQHFTFSLVNSSGTSEINSIVEGKILKLNAFS
AVATDWDSETRRLLYDEQEAQAFEKHGSMLQPQKKKAVVALRDCIELFTTMETLGEHDPW
YCPNCKKHQQATKKFDLWSLPRILVVHLKRFSYSRYWRDKLDTVVEFPIRGLNMSEFVCD
PRAGSYVYDLIAVSNHYGAMGVGHYTAYAKNKVNNKWYYFDDSSVSVASEDQIVTKAAYV
LFYERRNSEEHSAPSAPQEECDGMDTN
NT seq 2784 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggctgcggccggcgcggagcgggcccggccggacccggcggagcagcgggcc
gagctggggccgctcctggccacggccctccggcccggcgattcctggcggcagggcctg
cgattcgggacgcgccgcctcttaggggacgcgccgggcggtggcgtatgttgcaggtac
ttggtggagagccggtggttcaaacagtggaagaagtatgtgggcttcgacaactgggac
atgttcggcgccggccatcccaacctcttcccgggccccgtcgacaacgcgggcctgttc
ccggggcccatcgacaactcgggcctgttcggcgatccacaaactcagagtttaaaagaa
cacctcattgatgagctggattacgtgctggtgcccaccgaagcctggaacaaactagta
gcgtggtatggctgtatagacgggcagcagcctattgtgaggaaagtggtggagtacggg
ctgtttgtgaagcactataaggttgaggtttatctcctggagctgaagctgtgtgagagc
agtgatcctgacaatgtcatcaactgccacttcagcaaggcagatactgttgctactatt
gagaaagaaatgagaaaactattcagtatcccagctgagaaggaaaccaggctatggaac
aggtatatgagcaacacttatgagcagctcagcaagctggatagcacagtgcaagatgca
gggctctatcagggtcaggttgttttaatagaagtgaaaaatgaagatggcacgtggcct
ggacagcattgcctggcaaaaggttctgggtttgtctgtaactcttacaactgcagggac
agtgcttccctctcacaacctggactctgtggactcagtaaccttggaaacacctgcttc
atgaattctgcattacagtgcctgagcaatactcctcctctgactgactacttcctggaa
gataaatatgaagctgaaataaatcagaacaacccactggggatgaggggagaaatcgca
gaagcctatgcagatctcattaaacagatgtggtctgggagacagtctcatgtggcccca
cgtatgtttaaaacacaggttgggcgatttgctcctcagttctcaggataccagcagcaa
gattcccaggagctcttggctttcctactagatggcttgcatgaggatttgaacagagtg
aagaagaagccctacttggagctgaaggatgccaatggcagacctgattcggaagtggca
aaagaggcatgggagaatcataggctgaggaatgattccatcattgtggatatttttcat
ggtcttttcaagtctacccttgtttgtcccaaatgctctaaagtttctgtgacctttgat
cccttctgttacttaactctgccactgcccttgaggagggatcgtcccatggaagttacc
ctggtatatgcagacccacagcgcagacctgtccagtaccgggttgtggtgccagtgatg
ggggccatctcggatctgtgtgaatcactttccaaactctctggtgttcctgcagaaaat
atggtggtgacagacgtgtataatcacagattccacaaaatcttccaaatggatgaaggt
ttaaatcctatcatgccaaaagacgacatctttgtgtatgaagtttgcaagccaagtgag
gatggctcagagtatgttactctctccatttactttcgggaaaagacaatgaggcaatcc
agcaatacttcagggactgtgctctttgggcagccactgttaatatctgtgcccaaacac
aagctcactgtggatcacctgtacagtgtggttttggagcagatcagccgctgtgtgaaa
ctccctctggcagaagaatactccccaccctgcccagacagaggaacctgcaatggctcc
aatggtgtggttgaaggtgacatagaagagatggagcatcaggatggtggagaggaaggc
aaagaaaagctgacagaagttgacccctgccactctgagggttgtatgcaagtggagtca
gcaagggacctgcagccttgcaagaaacagcatttcacttttagccttgtgaattcatct
gggacctctgagataaactccattgttgaaggaaagatcttaaaactgaatgctttttct
gcagttgctactgactgggactctgagacacggaggctactttatgatgaacaggaggca
caggcatttgaaaaacatggaagcatgctacagccacagaagaagaaggctgttgtagcc
ctcagagactgcatagagctcttcactactatggaaacacttggtgaacatgacccgtgg
tactgccctaactgtaagaaacatcagcaggccacgaagaagtttgacttgtggtctttg
cccaggattttggtggtacatttaaaacgcttctcgtacagcagatactggagggataaa
cttgacacggttgtggaattccccatcaggggtttgaacatgtccgagttcgtctgcgac
ccgagggcaggctcatacgtgtatgacctcattgcagtatccaatcactatggagccatg
ggagtgggccactacactgcctacgccaagaacaaggtgaacaacaagtggtactacttc
gatgacagcagtgtctcggtggcttcagaagaccaaatagtgacaaaagctgcctatgtg
ctgttctatgagcgccgaaacagcgaggaacattctgccccctctgctccccaggaagaa
tgtgatggcatggacaccaactaa

DBGET integrated database retrieval system