KEGG   Taeniopygia guttata (zebra finch): 100228774Help
Entry
100228774         CDS       T01082                                 

Definition
NADH-cytochrome b5 reductase 3-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Amino sugar and nucleotide sugar metabolism
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tgu00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1A
AA seq 278 aa AA seqDB search
MRLFRNPQPAITLKDPEVKYALRLIDKEVISHDTRRFRFALPSMEHVLGLPLGQHIYLSA
RIDGALVVRPYTPVSSDDDKGFVDLVVKVYFRGVHPKFPDGGKMSQYLDSLKIGDTIDFR
GPSGLLVYKGKGKFDIRPEKKAEPVTKTVKYVGMIAGGTGITPMLQIIRAIIKDKDDSTI
CQLLFANQTEKDILLRSELDEIQAQNPGRFKCWYTLDTAPENWEYSQGFVNQEMIRDHLP
PPQSDVLILMCGPPPMIQYACIPNLDKLGYAKDMRFSF
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcttcaggaatccccagcctgcaattaccctcaaggacccagaagtgaagtat
gcactgaggctgattgataaggaggtaattagtcatgacacaaggagattccgatttgct
ctcccttccatggagcacgttctgggtctccctctagggcagcacatctacctgtctgca
cggattgatggagctctggttgtcagaccttacactccagtttccagtgatgatgacaag
ggctttgtggatcttgttgtgaaggtttacttcagaggtgtccatcccaagtttcctgat
ggagggaagatgtctcaatacttggacagcctgaaaataggggacaccattgacttcaga
ggaccaagtggcctccttgtgtacaaaggaaaaggcaagtttgatattcggccagaaaag
aaagctgaaccagttaccaagacagtgaaatacgtggggatgattgcaggggggactggg
ataacacctatgctgcagatcattcgagcaatcataaaggacaaagatgactccaccatt
tgccagctgctgtttgctaatcagactgagaaggatatcctgttacgttccgagctcgat
gagatccaggctcagaatcccggccgcttcaagtgttggtacacgctggacacagcacct
gaaaattgggaatacagccaaggatttgtgaaccaagagatgatccgagaccacctgccc
ccacctcagagcgatgttctgatcctcatgtgtggacctcctccaatgatccagtatgct
tgcattcccaacctggacaaactgggctatgccaaggacatgaggttctccttctaa

DBGET integrated database retrieval system