KEGG   Taeniopygia guttata (zebra finch): 100228856Help
Entry
100228856         CDS       T01082                                 

Gene name
ALPI
Definition
alkaline phosphatase, intestinal
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tgu00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 503 aa AA seqDB search
MGVCTVPAEEENPSFWYKQAAAAIDASLKLKPRIREAKNLIIFLGDGFGIPTITATRIFK
AQQRGKLGPETPLALDAFPYVSLSKTYNVDRQVPDSAGTATAYLCGVKGNYKTIGVSAAA
RFSECSTTAGNEVISVLERARKAGKAVGVVTTTRVQHASPSGTYAHVVNRDWYADASMPQ
EARLQGCKDIAWQLIHNVDINVILGGGRIYMTPVGTPDPEYPADSRQNGIREDGHNLINM
WLEARPGARYAWNRTEMLAAAADPNVKYLMGLFEPGDTKYNQVRNTTLDPSLTEMTEAAI
TILSRNPKGFYLFVEGGRIDHGHHEGSPHKALTEAVEFDQAIERAGTMTDEAETLTVITA
DHSHVFAFGGYTLRGSSIFALGQKKTTDGKNYTSILYGNGPGYRGGVRPNVDPATAMQFD
YQPQAAVPLESETHGGEDVAILAKGPMAHLFHGVQEQTYVAHAMAYAACIEPYTDCRQRD
SAPGIRATPLALLLPALLLPLFR
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtttgcactgtcccagcggaggaggagaatccatccttctggtacaagcaggca
gctgcagccatcgatgcctccttaaaactcaagcccaggatacgggaagccaaaaacctc
atcattttccttggggacggatttggaatccccaccatcacagccacccgcatctttaag
gcacagcagagggggaagctgggccctgagactcctcttgccctggatgccttcccctat
gtgtctctgtctaagacctacaatgtggacaggcaggtccctgacagcgcggggacagcc
acagcctatctctgtggggtgaagggcaactacaagaccataggggtgagtgcagccgcc
cgtttctcggagtgcagcaccacggccggcaacgaggtgatctccgtgctggagcgagcc
cgcaaagctgggaaggcagtgggcgtcgtgaccacgacacgggtgcagcacgcgtcgccc
tcgggaacctacgctcacgtggtgaaccgggactggtacgcggacgccagcatgccccag
gaggcgcggctgcagggctgcaaggacatcgcctggcagctgatccacaacgtcgacatc
aacgtgatcctgggagggggtcggatatacatgacccccgtggggacgccagaccccgag
taccctgccgacagcaggcagaatgggatccgtgaggatgggcacaacctcatcaacatg
tggctggaggcacggccgggtgcccgctatgcctggaacaggacagagatgctggctgct
gctgccgaccccaacgtgaagtatttgatgggtctctttgaacctggggacaccaagtac
aaccaggtgcgtaacaccaccctggacccgtcactcaccgagatgacggaggcagccatc
accatcctgagcaggaaccccaaaggcttctacctctttgtggaaggtggtagaatcgac
cacggccaccatgaaggttcaccccataaggcactgacggaggcagtggagtttgaccag
gccattgagcgggcaggaaccatgacagatgaggctgagaccctcaccgtcatcacagct
gaccactcgcacgtcttcgccttcggtggctacaccctgcgtggctcctccatcttcgcc
ctgggccaaaagaaaaccaccgacgggaagaactacacatcaattctctatgggaatggg
ccaggataccgaggtggtgtacggcccaatgtggacccagccacagcaatgcagttcgat
taccagccacaggcggctgtgcccctggagtcagagacccatggtggtgaggacgtggcc
atcctggccaagggccccatggcccacctcttccacggggtgcaggagcagacctatgta
gctcacgccatggcctacgccgcctgcatcgagccctacactgactgccgccaacgggac
tctgcccctggcatccgcgccacccccctggccctgctcctgcctgccctccttctgccc
ctcttccgctga

DBGET integrated database retrieval system