KEGG   Taeniopygia guttata (zebra finch): 100228866Help
Entry
100228866         CDS       T01082                                 

Gene name
USP35
Definition
ubiquitin specific peptidase 35
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.1.2.15]
Organism
tgu  Taeniopygia guttata (zebra finch)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 996 aa AA seqDB search
MDKILEAVVMSSYPNNVKQGLVRRVIEAAKQPMDSEQCWSMLELSTKLYLTGDTKYKREI
GKEVLEVYGHYHPEEFEEFFNVRFLLSLLQEGYGPLGKRSHYVLDYIQLGLQFVLESPSA
NSIFSLLRIEVLRKVCERPSPKQCAKISKLLTQHPQCIPTGKHQLLFCQQLIRCIGQFQC
VSEGEEEIMEFLEQVNKVSGLLQRIWRTQTSAILPSLKELFTIISSTEEQEAPSNALASV
VQFVPLELMDGVIRNLTNDDSITDVQMMMAIGRMIDWVSWPLGKNIDKWIIALLKGLAAV
KKFSILIEVTLSKIEKVFSKLLYPIVREGALSVLQYMLLSFQHSHEAFHLLLPHIPRLVA
SLKKEDSNSATSSLEQLAELIHCMFFRFSGFPDLYEPVLEAIKALPIPNEDRIKHLLGQN
AWTSQKNELACFYPRLASKSETGKIGLINLGNTCYMNSIIQSLFMASDFRHSVLNLTEGN
SQPLMTKLQWLFAFLEHSQRPAISPESFLSASWPPWFTPGAQQDCSEYLKYLLDRLHEEE
KTGKRIYQKLKESSLTSQAVEHHYLNKTLIEKMFGGKMMTKIRCLKCLNVSSREEAFTDL
SLAFPPSDRNVCGSTSILPVEEIGPQFIEPPENAGQLMGSPWIPRKAPMASDRAAPSVSV
ETLGFQEQGEAANPIRGNDVGVDAAKDPLSTFGEQACAPKDSRSVPDLINYFLSPERLTA
ENKYHCEKCASLQDAEKVAELTEGPHYLILTLLRFSFDPRTMKRKKILDNVSIPVVLKLP
ILIAPEETEEVCRHGKDGAVPGSGFMTVVYDLCSVVVHSGISSESGHYYCYSRECTDTVP
HGQPQDGVPKTASDKQLDFEIQWYLFNDTRVSFSSFESVSNVTSFFPKDTAYVLFYRQRP
DRQSCLLHEALAEAGRLHGEPSLHKDLMEAISKDNILFLQEQEKEARNRAAYISALPKSP
LWWRDLDRDKDDDSSSGGCSPAAGGGGSGSFHGLVF
NT seq 2991 nt NT seq  +upstreamnt  +downstreamnt
atggataagatactggaagctgtagtgatgtcctcttaccccaacaacgtgaaacaaggg
cttgtgaggcgcgtcatcgaggcggcgaagcagcccatggacagcgagcagtgctggtcc
atgctggagctgtccaccaagctttatctcactggggacaccaagtataaaagagagatt
gggaaagaggttttggaggtctatggccactatcacccagaggaatttgaggagttcttc
aacgtccgcttcctgctgagtctcctccaggaaggctatggacctctggggaagagaagc
cattatgtacttgattatatccagttaggactgcagtttgtcctggaaagcccatcagca
aacagcatcttcagcttactgaggatcgaggtgctccggaaggtctgtgagaggcccagc
cccaagcagtgtgcgaagatcagcaaactcctaacgcagcatcctcagtgcattcccacg
ggaaagcaccagctcctgttctgtcagcagctgatccgctgcatcgggcagttccagtgc
gtctccgagggggaagaggagatcatggagtttttggagcaggtgaacaaagtgagtggt
ctcctgcagagaatctggaggactcagacctcagccatcctgccctctttgaaagagctg
ttcactatcatttcttcaacagaggagcaggaagcgccctccaatgccttggccagcgtg
gttcagtttgtccctctggagctcatggatggcgtcataagaaacctcaccaatgatgac
agcatcactgatgtgcaaatgatgatggccattggcaggatgattgactgggtgtcctgg
cccctgggaaagaacatagacaagtggatcattgctctgctgaagggtttggctgcagtg
aaaaagttcagcatcttgattgaagtcactctttcaaaaatagaaaaggtcttctccaag
ctgctgtaccctattgtgagggagggggctttgtctgtcctgcagtacatgctgctgagc
ttccagcactcccacgaggcatttcacttgctgctccctcacatccccaggctggtggcc
tccttgaagaaggaggactccaattctgcaaccagctccctggagcagctggccgagctc
atccactgcatgttcttccgcttctcaggattcccagacctctatgaaccagtcctagaa
gcaataaaagctctcccaattccaaatgaagacaggattaaacacctcttgggacaaaat
gcttggacctcccagaagaatgagctggcctgcttctacccacgcctggcatctaaatca
gagacaggaaagattgggttaattaacttgggaaacacttgctacatgaacagcatcata
cagtctcttttcatggcttcagactttcggcattcagtgttgaatttaactgagggcaac
tcccagcccctgatgacaaagctccagtggctctttgcatttttggagcacagtcagcga
cctgccatctcccctgagagcttcctctctgcctcctggccaccctggttcacccctgga
gctcagcaggactgctcagagtacctcaagtatttgctggaccgattgcatgaagaggaa
aaaactggaaaaaggatctaccagaaactcaaggaatccagcttgacgtctcaggcggtg
gagcatcattacttaaacaagacattgattgagaagatgtttgggggtaaaatgatgaca
aagatccgctgcttgaaatgcctcaatgtttcctcccgagaagaagccttcacagacctg
tccctggcttttcctccatcggacaggaatgtgtgtgggagcacatctattctaccagtg
gaagaaattggcccacagttcattgaacctccagaaaatgcaggccagcttatgggctct
ccctggatcccgaggaaggctcccatggccagtgaccgtgcagccccatcagtgtcggtg
gaaacattaggtttccaggaacaaggagaagcagcaaatcccatacgtggcaatgatgtt
ggggtggatgcagccaaagaccctctctcaacttttggggagcaggcatgtgctcccaag
gactccagatctgttccagatttaatcaactattttctatccccggagagactgacagca
gagaataaataccactgtgagaaatgtgcatccctgcaggatgctgagaaggtggcagag
ctgacagagggtccacactacctcatcctcacactgctgcggttttccttcgacccacgg
actatgaagaggaagaagatcttggacaatgtctccatccctgtggtgctcaagctaccc
atccttattgctccagaggaaactgaggaggtttgccggcatgggaaggatggtgctgtc
ccagggagtggcttcatgactgttgtgtatgacctctgcagcgtggtggtgcattcaggc
atctcctccgagagtggccactactactgctactccagggagtgcactgacaccgtcccc
catgggcagccccaggatggggtgccaaagacagcctctgacaaacagctggactttgaa
atccagtggtacctcttcaatgacaccagagtttccttctcctccttcgagtcggtcagc
aacgtcacctcattcttccccaaggacactgcctatgtcctcttctaccggcagcggccg
gaccggcagagctgcctgctgcacgaggctctggctgaggccggccgcctgcatggtgaa
ccgtccctccacaaggacttgatggaagccatttccaaagataacatcctcttcttgcag
gaacaggaaaaagaagcgaggaacagagctgcctatatttctgccttgccgaaatccccg
ctgtggtggagagacttggaccgggacaaggacgatgacagctcgtctgggggctgcagc
ccagcagcgggcgggggtggatccggctccttccatggacttgtcttttag

DBGET integrated database retrieval system