KEGG   Taeniopygia guttata (zebra finch): 100228872Help
Entry
100228872         CDS       T01082                                 

Definition
cytochrome P450 2C21-like
Orthology
K07413  
cytochrome P450, family 2, subfamily C [EC:1.14.14.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:tgu00140]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:tgu00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:tgu00591]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:tgu00830]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 496 aa AA seqDB search
MKMELLGGVTVVLLVCIACLLSFAAWKGRSGKGKMPPGPAPLPILGNLLQVKPSNMTKTL
QKLSEEYGPVFTVHLGSDPVVVLYGHDVVKEALVDRADEFAARGHMPIGDRTNKGLGIIF
SNNELWLQGRRFSLTTLRNFGMGKRSIEERIQEESDYLLEEINKTKRTPFDPTFMLSCAV
SNVICSIVFGKRYDYKDKKFLALMNNMNNIFEMMNSRWGQLYQMFSNILDYLPGPHNNIF
AEFDALKAFVAEEVKLHQASLDPSSPQDFIDCFLCKMQEEKDRPNSSFYMKNLITSTFDL
FLAGTETTSTTLRYGLLLLLKYPKIQEKIQEEIDQVVGQSRKPCVADRTQMPYTDAVVHE
IQRFITLIPLALPHTVTKDTTFRDYIIPKGTTVFPVLASVLHDSKEFPNPHEFNPEHFLN
KNGSFRKSNFFMPFSAGKRICPGEGLARMEIFLLIATILQKFTLKSVVNPQELNITPTLS
GTGNVPPAYQLCAVPR
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatggagctcctgggaggagtcactgttgttctcctggtttgcattgcttgcctg
ctctcctttgcagcatggaaaggaaggtctggaaaggggaagatgcctccaggaccagct
ccccttcccattctaggtaacctgctgcaggtgaaaccaagtaacatgaccaaaaccctc
cagaagctcagtgaagagtatggacccgtgttcacagtgcacctgggctctgacccagtg
gtggtgctgtatggacacgatgtggtgaaagaagccttggtcgatcgcgcagacgagttt
gctgccagaggacatatgccaattggagacaggactaacaagggattagggattattttt
agcaacaatgagctatggttacaaggccggcggttttctctcaccactctgcggaacttt
ggaatggggaagaggagcattgaagagagaatacaagaggaatctgactacttgctggaa
gagatcaacaaaacaaagagaacaccttttgacccaaccttcatgctgagctgtgctgtc
tccaatgtcatatgctccattgtctttgggaaacggtatgattataaagataaaaagttc
ttggctctgatgaacaacatgaacaacatctttgagatgatgaactcccgctggggacag
ctctaccagatgttctcaaatatcctggattacctgcctggcccgcacaataatatattt
gcagaatttgatgctctaaaagcctttgtagcagaggaggtgaagttacaccaagcctcc
ctagatcccagctctcctcaggatttcatcgactgtttcctctgcaaaatgcaggaggag
aaagatcgtcccaattccagtttctacatgaagaacctgataacaagcactttcgacttg
ttccttgctggaacagagacaacaagcaccactctacgatatgggcttctgcttcttctc
aaatatccaaagatacaagagaaaattcaagaagagattgaccaggtggtaggacaatca
agaaaaccctgtgtggctgaccggacccagatgccctacacagatgctgtggtccatgaa
atccagcgcttcatcactcttatccccctggctctccctcacactgtgaccaaagacacc
accttcagagactacatcattcctaagggcaccacggttttccctgtcctcgcttctgtc
ctccatgacagtaaagagtttccaaacccacacgagttcaatcctgaacatttcttgaat
aagaatggcagctttaggaagagcaacttcttcatgcccttctcagcaggaaaacgaata
tgcccaggagagggcctggcacgaatggagatattcttactcatagccaccatcttgcag
aaatttactttgaagtctgttgtgaatcctcaggagctcaacataaccccaactctgagt
gggacaggcaatgtacctcctgcctaccagctctgtgctgtcccccgctga

DBGET integrated database retrieval system