KEGG   Taeniopygia guttata (zebra finch): 100228872Help
Entry
100228872         CDS       T01082                                 

Definition
cytochrome P450 2C21-like
Orthology
K07413  
cytochrome P450, family 2, subfamily C [EC:1.14.14.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100228872
   00590 Arachidonic acid metabolism
    100228872
   00591 Linoleic acid metabolism
    100228872
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100228872
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100228872
Cytochrome P450 [BR:tgu00199]
 Cytochrome P450, animal type
  CYP2 family
   100228872
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 496 aa AA seqDB search
MKMELLGGVTVVLLVCIACLLSFAAWKGRSGKGKMPPGPAPLPILGNLLQVKPSNMTKTL
QKLSEEYGPVFTVHLGSDPVVVLYGHDVVKEALVDRADEFAARGHMPIGDRTNKGLGIIF
SNNELWLQGRRFSLTTLRNFGMGKRSIEERIQEESDYLLEEINKTKRTPFDPTFMLSCAV
SNVICSIVFGKRYDYKDKKFLALMNNMNNIFEMMNSRWGQLYQMFSNILDYLPGPHNNIF
AEFDALKAFVAEEVKLHQASLDPSSPQDFIDCFLCKMQEEKDRPNSSFYMKNLITSTFDL
FLAGTETTSTTLRYGLLLLLKYPKIQEKIQEEIDQVVGQSRKPCVADRTQMPYTDAVVHE
IQRFITLIPLALPHTVTKDTTFRDYIIPKGTTVFPVLASVLHDSKEFPNPHEFNPEHFLN
KNGSFRKSNFFMPFSAGKRICPGEGLARMEIFLLIATILQKFTLKSVVNPQELNITPTLS
GTGNVPPAYQLCAVPR
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatggagctcctgggaggagtcactgttgttctcctggtttgcattgcttgcctg
ctctcctttgcagcatggaaaggaaggtctggaaaggggaagatgcctccaggaccagct
ccccttcccattctaggtaacctgctgcaggtgaaaccaagtaacatgaccaaaaccctc
cagaagctcagtgaagagtatggacccgtgttcacagtgcacctgggctctgacccagtg
gtggtgctgtatggacacgatgtggtgaaagaagccttggtcgatcgcgcagacgagttt
gctgccagaggacatatgccaattggagacaggactaacaagggattagggattattttt
agcaacaatgagctatggttacaaggccggcggttttctctcaccactctgcggaacttt
ggaatggggaagaggagcattgaagagagaatacaagaggaatctgactacttgctggaa
gagatcaacaaaacaaagagaacaccttttgacccaaccttcatgctgagctgtgctgtc
tccaatgtcatatgctccattgtctttgggaaacggtatgattataaagataaaaagttc
ttggctctgatgaacaacatgaacaacatctttgagatgatgaactcccgctggggacag
ctctaccagatgttctcaaatatcctggattacctgcctggcccgcacaataatatattt
gcagaatttgatgctctaaaagcctttgtagcagaggaggtgaagttacaccaagcctcc
ctagatcccagctctcctcaggatttcatcgactgtttcctctgcaaaatgcaggaggag
aaagatcgtcccaattccagtttctacatgaagaacctgataacaagcactttcgacttg
ttccttgctggaacagagacaacaagcaccactctacgatatgggcttctgcttcttctc
aaatatccaaagatacaagagaaaattcaagaagagattgaccaggtggtaggacaatca
agaaaaccctgtgtggctgaccggacccagatgccctacacagatgctgtggtccatgaa
atccagcgcttcatcactcttatccccctggctctccctcacactgtgaccaaagacacc
accttcagagactacatcattcctaagggcaccacggttttccctgtcctcgcttctgtc
ctccatgacagtaaagagtttccaaacccacacgagttcaatcctgaacatttcttgaat
aagaatggcagctttaggaagagcaacttcttcatgcccttctcagcaggaaaacgaata
tgcccaggagagggcctggcacgaatggagatattcttactcatagccaccatcttgcag
aaatttactttgaagtctgttgtgaatcctcaggagctcaacataaccccaactctgagt
gggacaggcaatgtacctcctgcctaccagctctgtgctgtcccccgctga

DBGET integrated database retrieval system