KEGG   Taeniopygia guttata (zebra finch): 100228937Help
Entry
100228937         CDS       T01082                                 

Definition
cytochrome P450 4B1-like
Orthology
K07426  
cytochrome P450, family 4, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100228937
Cytochrome P450 [BR:tgu00199]
 Cytochrome P450, animal type
  CYP4 family
   100228937
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 508 aa AA seqDB search
MASLLDNITRPSAAVLQLSVLFGIIFVLLKVLQLYWERKKLIKALEAFPGPPKHWLYGHN
HLIKSESFLHQIVAWGQEYPYAFPRWFGPTLPSIIIHHPEYAKTILGRADPKASAVYKLL
VPWIGKGLLILDGSKWFQHRKMLTPAFHYDVLKSYVTLMSDSVKVMLDKWDKKITERRSV
ELFQDVSLMTLDTIMKSAFSFNSNCQTQSDSHYYIRAIFDVTYLLSNRIRNLSFTDVFYN
FTCNGRAFQNACKLARTHTDQVIKERKMLLSNEKELEKIQKKRHLDFLDILLCSKDENGV
GLSDEDLRAEVDTFMFEGHDTVASALSWLFYCMSLHPEHQQRCREEVQGILGHRDTIEWE
DLGKMTYTTMCIKESLRLFPPVTSVSRELSKPITFPDGRSLPAGCQVGVNIFAIHRNRDV
WENPEIYDPLRFSPENSAQRHSHAFLPFSAGSRNCIGLQFAMNEIKVALALTLQRFELCP
DPSKLPIMISQIILRSSNGIHLHLKKIF
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggcatctctgctggacaacataaccagaccttctgctgccgtcctgcagctctctgtg
ctgtttggtataatctttgtgctgctgaaagtgctgcagttgtactgggagaggaagaag
ctcatcaaagctctggaggcattccctggccccccaaaacactggctctatggccacaat
cacctgataaaatctgaaagttttttacaccaaatagtggcatggggacaagaatatcca
tatgcctttcccagatggtttggaccaaccctgccatccataatcatccaccatcctgaa
tacgccaaaaccatacttggccgagcagatcccaaggctagtgcagtctacaaactcctg
gttccctggattgggaaagggctgctgatcttggatggaagcaaatggttccagcacagg
aagatgctcaccccagcctttcattacgatgtgctgaaatcttacgtgaccctgatgtca
gattcagttaaagtgatgctggataaatgggacaagaagatcacagagaggaggtcagtg
gagctctttcaagatgtcagcttgatgacactagataccatcatgaaaagtgccttcagt
tttaattccaactgtcagactcagagtgactcccactattatattagagctatttttgat
gtgacctacctcctgagcaataggatccggaatctttccttcacggatgtcttctacaac
ttcacttgcaacggccgcgcgtttcagaatgcctgcaagctggcccgaacccacacagat
caggtaataaaagaaagaaagatgttgctctccaatgagaaggagcttgaaaagatccag
aagaagaggcacctggattttctggacattcttctttgtagcaaggatgagaatggagtt
ggactgtccgatgaggacctgcgtgccgaggtggacaccttcatgtttgagggtcatgat
accgtggccagtgcactctcctggctcttctactgcatgtcactgcaccctgagcaccag
cagcggtgcagggaggaggtccagggcatcctgggacaccgagataccattgagtgggag
gatcttgggaagatgacctacaccaccatgtgcatcaaagagagcttacgcctgttccca
ccagttacttctgtgtcccgagagctctccaaacccatcacatttcctgatggacgcagc
ctgccagcaggctgccaggttggagtgaatatatttgctattcacaggaaccgggatgtg
tgggagaaccctgagatttatgatcccctaaggttttctccagagaactcagcacagagg
cactcccatgcttttctgcctttctctgctggatccaggaactgcattgggctgcagttt
gccatgaatgagattaaagtggcgctggccttgaccctgcagcgcttcgagctctgcccg
gacccatccaagcttcccataatgatatcacagatcatccttaggtccagcaacgggata
cacctgcatttgaagaagattttctga

DBGET integrated database retrieval system