KEGG   Taeniopygia guttata (zebra finch): 100229058Help
Entry
100229058         CDS       T01082                                 

Gene name
PPP3R1
Definition
(RefSeq) protein phosphatase 3 regulatory subunit B, alpha
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04010  MAPK signaling pathway
tgu04020  Calcium signaling pathway
tgu04114  Oocyte meiosis
tgu04218  Cellular senescence
tgu04310  Wnt signaling pathway
tgu04370  VEGF signaling pathway
tgu04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100229058 (PPP3R1)
   04310 Wnt signaling pathway
    100229058 (PPP3R1)
   04370 VEGF signaling pathway
    100229058 (PPP3R1)
   04020 Calcium signaling pathway
    100229058 (PPP3R1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100229058 (PPP3R1)
   04218 Cellular senescence
    100229058 (PPP3R1)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    100229058 (PPP3R1)
Protein phosphatases and associated proteins [BR:tgu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100229058 (PPP3R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Motif
Other DBs
NCBI-GeneID: 100229058
NCBI-ProteinID: XP_002199881
Ensembl: ENSTGUG00000018231
Position
3
AA seq 170 aa AA seqDB search
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaggcaagctaccctttggaaatgtgctcgcactttgatgctgatgagata
aaaagactaggaaagagatttaagaagcttgatttggacaactctggttctctgagcgtg
gaagagttcatgtctttacctgaattgcaacagaacccgttagtacagcgagtaatagat
atatttgacacagatggcaatggagaagtggattttaaagaatttatagaaggagtctcc
cagttcagtgtcaaaggagataaagaacagaagttgaggtttgcttttcgcatttatgat
atggacaaagatggctatatctcaaatggagagctcttccaggtgctgaagatgatggtt
gggaacaatctcaaagacactcagttacagcaaattgtagataaaaccataattaatgca
gataaggatggtgatggaagaatatcctttgaagaattttgtgctgttgtaggaggccta
gatatccacaaaaagatggtcgtagatgtgtga

DBGET integrated database retrieval system