KEGG   Taeniopygia guttata (zebra finch): 100229073Help
Entry
100229073         CDS       T01082                                 

Gene name
AP2B1
Definition
adaptor-related protein complex 2, beta 1 subunit
Orthology
K11825  
AP-2 complex subunit beta-1
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100229073 (AP2B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
19
AA seq 953 aa AA seqDB search
MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQT
DNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITE
YLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANA
VAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSI
CERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQY
VALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKE
YATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRK
YPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQV
QLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEV
VLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGST
DAGDSPVGTTTTTNLEQPQVIPFQGDLLGDLLNLDLGPPVNVPQVPMCFVQMGAVDLLGG
GLDSLLGSDLGGGVGGSPAVGQTYIPTAVPTTFAPSPTPAVVKSELNDLFELSSGIGMAP
GGYVAPKSVWLPAVKAKGLEISGTFSHRQGHIHMEMNFTNKALQHMTDFAIQFNKNSFGV
IPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNV
LFVEDGKMERQVFLATWKDIPNENELQFQIKDCHLNADTVSSKLQNNNVYTIAKRNVEGQ
DMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQAYDAILKN
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgacggactccaaatacttcacgaccaataaaaaaggagagatttttgagctgaaggct
gaactcaacaatgaaaagaaagagaagaggaaagaagctgtaaagaaggttattgcagcc
atgactgtggggaaggatgtcagctctctgttccctgatgttgtcaactgcatgcagact
gacaacctggagctgaagaagctggtctacctgtacctgatgaactatgccaaaagccag
ccagacatggccatcatggctgtcaacagctttgtgaaggactgcgaggacccgaacccc
ctgatccgcgcgctggccgtgcgcaccatgggctgcatccgcgtggataaaatcaccgag
tacctgtgcgagcccctgcgcaagtgtctgaaggatgaggacccctacgtgaggaaaact
gcagctgtctgcgtggccaagctgcacgacatcaatgcccagatggtggaggaccaaggg
ttcctggattccctgcgggacctgatcgcagactccaatcccatggtggtagcgaatgcc
gtggccgccctgtcggagatcagtgagtcccaccccaacagcaacctgctggatctgaac
ccccagaacatcaacaagctgctgacagctttaaatgagtgcacagagtgggggcagatc
ttcatcctggactgtctgtccaactacaaccccaaggatgaccgggaagctcagagcatc
tgtgagcgggtgaccccccggctgtctcacgccaactcggcagtggtgctgtcagcagtg
aaggtcctgatgaagttcctggagctgcttcccaaggactctgattattacaacatgctg
ctgaagaaacttgcccctcctctggtgaccctgctgtctggagagcctgaagtgcagtat
gttgccctgaggaacatcaacttgattgtgcagaagaggcctgaaatcctgaagcaggag
atcaaagtgttctttgtgaagtacaacgaccccatctatgtcaaactggagaaactggac
atcatgatccgcctggcctcccaagcaaacattgcccaggtcctggcagagctcaaggaa
tacgccaccgaggtggacgtcgacttcgtgcgcaaggccgtgcgagccatcggccgctgt
gccatcaaggtggagcaatctgcagagcgctgtgtgagcacactgctggacctcatccag
accaaggtgaactacgtggtgcaggaggccatcgtggtcatcagggacatcttccgcaag
taccccaacaagtatgagagcatcattgccactctgtgtgagaacctggattccctggat
gagccagatgccagagctgccatgatttggatagtgggtgaatatgctgaaagaattgac
aatgcagatgagctgctggagagtttcctggagggtttccatgatgaaagcactcaggtg
cagctcaccctcctgactgcaatagtgaagctgttcttgaaaaagccttctgagacacag
gagctggtgcagcaggtcctcagcctggccacacaggattctgacaacccagacctgcgg
gatcgtggctacatctactggcgccttctttccacggatccagtgactgccaaggaagtg
gtgctctcagaaaagccactgatttctgaggagactgatctgattgagccaaccctgctg
gatgagctcatctgccacattgggtctctggcttctgtgtaccacaaaccacccaacgcc
ttcgtggagggcagccacggcatccaccgcaagcacctgccaatccaccatgggagcact
gatgctggtgacagccccgtgggcaccacgaccaccacaaacctggagcagccacaggtc
atcccattccagggtgacctcctgggggatctcctcaacctggacctggggccccctgtg
aatgtgccccaagtgcccatgtgcttcgtgcagatgggtgctgtggacctcctgggagga
gggctggacagcttgcttggcagtgaccttggcgggggcgttggaggaagcccggcagtg
ggacagacctacattcccaccgctgtgccaaccacctttgccccttctcccaccccagca
gtggtcaagagtgaactcaacgatctctttgagctctcatctggcatagggatggctcct
ggaggatatgtggctcccaagtctgtttggctgcctgcagtgaaggctaaaggattggag
atctcaggcacattcagccacaggcagggacacatccacatggagatgaactttaccaat
aaggctttgcagcacatgactgactttgccattcagttcaataagaacagctttggagtc
atcccaagcacccccctggccattcacacacctctgatgccaaaccaaagtattgatgtc
tccctgcccctcaacaccctgggaccagtgatgaaaatggagcctctgaacaacctccag
gtggctgtgaaaaacaacattgatgtcttttacttcagctgcctaatccctctcaacgtg
ctcttcgtggaggatggcaaaatggagcgccaggtcttccttgcaacatggaaggatatt
ccaaatgaaaatgagcttcagttccagattaaagattgtcacctgaatgctgacactgtc
tccagcaagctgcagaacaacaatgtgtacaccattgccaagaggaacgtggaggggcag
gacatgctctaccagtccctgaagctcaccaacggcatctggatcctggctgagctgcgc
atccagcccgggaaccccaactacacgctctccctgaaatgccgagctccagaagtgtcc
cagtacatctaccaggcctacgatgccatcttgaaaaactaa

DBGET integrated database retrieval system