KEGG   Taeniopygia guttata (zebra finch): 100229114Help
Entry
100229114         CDS       T01082                                 

Gene name
PAK2
Definition
p21 protein (Cdc42/Rac)-activated kinase 2
Orthology
K04410  
p21-activated kinase 2 [EC:2.7.11.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Focal adhesion
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100229114 (PAK2)
   04012 ErbB signaling pathway
    100229114 (PAK2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100229114 (PAK2)
  Cellular commiunity
   04510 Focal adhesion
    100229114 (PAK2)
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100229114 (PAK2)
Protein kinases [BR:tgu01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   100229114 (PAK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 529 aa AA seqDB search
MSDNGELEDKPPAPPVRMSSAIFSAGGKDQLVTNNSFKPLPSVPEERKPRHKIISIFYSN
EKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSKDTAKQKYLSFSDKQVQFYNFSSKFSLKVTNAKGSEPSTAVADDDEDD
EEAPPPVIAPRPDHTKSIYTRSVIDPIPAPAGDTCADSASKAGDKQKKKTKMSDEDIMEK
LRTIVSIGDPKKKYTRYEKIGQGASGTVFTAIDVATGQEVAIKQINLQKQPKKELIINEI
LVMKELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQA
LEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVV
TRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRD
FLNRCLEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLILAAKEAMKSNR
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaacggagaactggaagacaagccccccgcccctcctgtccggatgagcagt
gctatcttcagtgcagggggcaaagaccagttggtgaccaacaacagctttaaacccctg
ccctctgtcccagaagagaggaaacccaggcataaaatcatctccatattctatagcaat
gaaaaaggaagcaagaagaaggaaaaggaaaggccagaaatctccccaccgtcagatttt
gagcacaccatccatgttggctttgatgctgttactggagagttcactggaatgccagaa
caatgggctcggttgcttcagacctcaaatatcaccaagctagaacagaagaaaaacccc
caggcggtactagatgtgctgaaattctacgactccaaagacacagcaaaacagaaatat
ctgagtttttctgacaaacaggtgcagttttacaacttttcttccaaattctctctgaaa
gtaaccaatgccaaaggttcagaaccatcaacagctgtggcagatgatgatgaggatgat
gaagaggctcctcctcctgtgattgctccacggccagatcacacaaaatcgatttacacc
cgctctgtcattgaccccatccctgccccggccggtgacacctgcgccgacagcgcctcc
aaagcaggggacaagcagaaaaagaaaaccaagatgtcagatgaagacatcatggaaaaa
ctacgtactattgtaagcataggagatcctaagaaaaaatacaccagatatgaaaaaatc
gggcagggggcttcaggtacagttttcacagctattgatgtggcaacaggacaggaggtg
gctattaaacagatcaatttgcagaaacagcccaagaaggagctgataattaatgagatc
ttggtaatgaaggagctaaagaaccccaacatagtcaacttcctggacagttacctcgta
ggggatgagttgtttgtggtgatggagtatctggctggaggctctctaacagatgtggtc
acagagacgtgtatggatgaagcacagattgctgctgtctgcagagagtgcttgcaagcg
cttgagttcctccatgccaaccaggtgatccacagggacataaagagtgacaatgtgctg
ttaggaatggatggatcagttaaattaactgactttgggttctgtgcccagatcacccct
gagcaaagcaagcgcagcaccatggtgggaactccatactggatggctcccgaggtggtc
acacggaaagcctacggccccaaagtggacatctggtccctgggcatcatggctattgag
atggtggaaggagagcccccatacctcaacgagaaccccctgagggctttatatttgata
gcaactaatggcacaccagaactccagaaccccgagaaactgtccccaatattccgggat
ttcttgaaccgatgtttggagatggatgtggaaaaaagaggatcagccaaagaattgcta
cagcatcccttcttgaaactggccaaacctctgtccagcttgacgccactgatcctggca
gccaaagaagcaatgaagagtaaccgctaa

DBGET integrated database retrieval system