KEGG   Taeniopygia guttata (zebra finch): 100229114Help
Entry
100229114         CDS       T01082                                 

Gene name
PAK2
Definition
(RefSeq) p21 (RAC1) activated kinase 2
  KO
K04410  
p21-activated kinase 2 [EC:2.7.11.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Focal adhesion
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100229114 (PAK2)
   04012 ErbB signaling pathway
    100229114 (PAK2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100229114 (PAK2)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100229114 (PAK2)
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100229114 (PAK2)
Protein kinases [BR:tgu01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   100229114 (PAK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 525 aa AA seqDB search
MSDNGELEDKPPAPPVRMSSAIFSAGGKDQLVTNNSFKPLPSVPEERKPRHKIISIFYSN
EKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSKDTAKQKYLSFSAPEKDGFPSGTPTTNAKGSEPSTAVADDDEDDEEAP
PPVIAPRPDHTKSIYTRSVIDPIPAPAGDTCADSASKAGDKQKKKTKMSDEDIMEKLRTI
VSIGDPKKKYTRYEKIGQGASGTVFTAIDVATGQEVAIKQINLQKQPKKELIINEILVMK
ELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFL
HANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA
YGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNR
CLEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLILAAKEAMKSNR
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaacggagaactggaagacaagccccccgcccctcctgtccggatgagcagt
gctatcttcagtgcagggggcaaagaccagttggtgaccaacaacagctttaaacccctg
ccctctgtcccagaagagaggaaacccaggcataaaatcatctccatattctatagcaat
gaaaaaggaagcaagaagaaggaaaaggaaaggccagaaatctccccaccgtcagatttt
gagcacaccatccatgttggctttgatgctgttactggagagttcactggaatgccagaa
caatgggctcggttgcttcagacctcaaatatcaccaagctagaacagaagaaaaacccc
caggcggtactagatgtgctgaaattctacgactccaaagacacagcaaaacagaaatat
ctgagtttttctgctccagaaaaagatggtttcccttcaggaacaccaacgaccaatgcc
aaaggttcagaaccatcaacagctgtggcagatgatgatgaggatgatgaagaggctcct
cctcctgtgattgctccacggccagatcacacaaaatcgatttacacccgctctgtcatt
gaccccatccctgccccggccggtgacacctgcgccgacagcgcctccaaagcaggggac
aagcagaaaaagaaaaccaagatgtcagatgaagacatcatggaaaaactacgtactatt
gtaagcataggagatcctaagaaaaaatacaccagatatgaaaaaatcgggcagggggct
tcaggtacagttttcacagctattgatgtggcaacaggacaggaggtggctattaaacag
atcaatttgcagaaacagcccaagaaggagctgataattaatgagatcttggtaatgaag
gagctaaagaaccccaacatagtcaacttcctggacagttacctcgtaggggatgagttg
tttgtggtgatggagtatctggctggaggctctctaacagatgtggtcacagagacgtgt
atggatgaagcacagattgctgctgtctgcagagagtgcttgcaagcgcttgagttcctc
catgccaaccaggtgatccacagggacataaagagtgacaatgtgctgttaggaatggat
ggatcagttaaattaactgactttgggttctgtgcccagatcacccctgagcaaagcaag
cgcagcaccatggtgggaactccatactggatggctcccgaggtggtcacacggaaagcc
tacggccccaaagtggacatctggtccctgggcatcatggctattgagatggtggaagga
gagcccccatacctcaacgagaaccccctgagggctttatatttgatagcaactaatggc
acaccagaactccagaaccccgagaaactgtccccaatattccgggatttcttgaaccga
tgtttggagatggatgtggaaaaaagaggatcagccaaagaattgctacagcatcccttc
ttgaaactggccaaacctctgtccagcttgacgccactgatcctggcagccaaagaagca
atgaagagtaaccgctaa

DBGET integrated database retrieval system