KEGG   Taeniopygia guttata (zebra finch): 100229114Help
Entry
100229114         CDS       T01082                                 

Gene name
PAK2
Definition
p21 protein (Cdc42/Rac)-activated kinase 2
Orthology
K04410  
p21-activated kinase 2 [EC:2.7.11.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Focal adhesion
Regulation of actin cytoskeleton
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:tgu04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:tgu04012]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:tgu04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:tgu04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 529 aa AA seqDB search
MSDNGELEDKPPAPPVRMSSAIFSAGGKDQLVTNNSFKPLPSVPEERKPRHKIISIFYSN
EKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSKDTAKQKYLSFSDKQVQFYNFSSKFSLKVTNAKGSEPSTAVADDDEDD
EEAPPPVIAPRPDHTKSIYTRSVIDPIPAPAGDTCADSASKAGDKQKKKTKMSDEDIMEK
LRTIVSIGDPKKKYTRYEKIGQGASGTVFTAIDVATGQEVAIKQINLQKQPKKELIINEI
LVMKELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQA
LEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVV
TRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRD
FLNRCLEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLILAAKEAMKSNR
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaacggagaactggaagacaagccccccgcccctcctgtccggatgagcagt
gctatcttcagtgcagggggcaaagaccagttggtgaccaacaacagctttaaacccctg
ccctctgtcccagaagagaggaaacccaggcataaaatcatctccatattctatagcaat
gaaaaaggaagcaagaagaaggaaaaggaaaggccagaaatctccccaccgtcagatttt
gagcacaccatccatgttggctttgatgctgttactggagagttcactggaatgccagaa
caatgggctcggttgcttcagacctcaaatatcaccaagctagaacagaagaaaaacccc
caggcggtactagatgtgctgaaattctacgactccaaagacacagcaaaacagaaatat
ctgagtttttctgacaaacaggtgcagttttacaacttttcttccaaattctctctgaaa
gtaaccaatgccaaaggttcagaaccatcaacagctgtggcagatgatgatgaggatgat
gaagaggctcctcctcctgtgattgctccacggccagatcacacaaaatcgatttacacc
cgctctgtcattgaccccatccctgccccggccggtgacacctgcgccgacagcgcctcc
aaagcaggggacaagcagaaaaagaaaaccaagatgtcagatgaagacatcatggaaaaa
ctacgtactattgtaagcataggagatcctaagaaaaaatacaccagatatgaaaaaatc
gggcagggggcttcaggtacagttttcacagctattgatgtggcaacaggacaggaggtg
gctattaaacagatcaatttgcagaaacagcccaagaaggagctgataattaatgagatc
ttggtaatgaaggagctaaagaaccccaacatagtcaacttcctggacagttacctcgta
ggggatgagttgtttgtggtgatggagtatctggctggaggctctctaacagatgtggtc
acagagacgtgtatggatgaagcacagattgctgctgtctgcagagagtgcttgcaagcg
cttgagttcctccatgccaaccaggtgatccacagggacataaagagtgacaatgtgctg
ttaggaatggatggatcagttaaattaactgactttgggttctgtgcccagatcacccct
gagcaaagcaagcgcagcaccatggtgggaactccatactggatggctcccgaggtggtc
acacggaaagcctacggccccaaagtggacatctggtccctgggcatcatggctattgag
atggtggaaggagagcccccatacctcaacgagaaccccctgagggctttatatttgata
gcaactaatggcacaccagaactccagaaccccgagaaactgtccccaatattccgggat
ttcttgaaccgatgtttggagatggatgtggaaaaaagaggatcagccaaagaattgcta
cagcatcccttcttgaaactggccaaacctctgtccagcttgacgccactgatcctggca
gccaaagaagcaatgaagagtaaccgctaa

DBGET integrated database retrieval system