KEGG   Taeniopygia guttata (zebra finch): 100229147Help
Entry
100229147         CDS       T01082                                 

Gene name
GTF3C4
Definition
general transcription factor IIIC, polypeptide 4, 90kDa
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100229147 (GTF3C4)
Transcription machinery [BR:tgu03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     100229147 (GTF3C4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 937 aa AA seqDB search
MSRPLLRRTPGPPPTRPGPLAVLEQLSDVHSGGQDMVIHRTAVPAPGTACTLKVGPKKEV
AECKEKFASSVDPTVSQTFMLDRVFNPEGKSLTPMRGFKYSSWSPLGCDANGRCLLAALT
MDNRLTIHANLNRLQWVQLVDLTELYGERLFEASYRLSPDSLFTAVRREPAVRLQHGASG
LDPLACSEDHRVSVSTARSIAVLEQISDVHSGGQDMVIHRTAVPAPGTACTLKGKRLGSS
KEVAECKEKFASSVDPTVSQTFMLDRVFNPEGKSLTPMRGFKYSSWSPLGCDANGRCLLA
ALTMDNRLTIHANLNRLQWVQLVDLTELYGERLFEASYRLCKADAPCGELGDFPEFQRRH
SMQAPVRMEWSGICTTQQVKHNNECRDVGSVLLAVLFENGNIAVWQFQLPFLGKESITSC
NTIESGISSPSVLSWWEYEHNNRKMSGLIVGSAYGPVKIIPVNLKAVKGYFTLRQPVVLW
QEMDQLPVHSIKCIPLYHPYQKCSCSLVVAARGPYVFWCLLLISKAGLNVHNSHVTGLHS
LPIVSMTADKQNGTVYTCSSDGKVRQLIPIFTDVALKFEHQVIKLSEVFGCVRTHGIAVS
PCGAYLAVITTEGMANGLHPVNKNYQVQFVTLKTFEEAAAQLLESSVQNLFRQVDLTDLV
RWKILKDKHIPQFLQEALDKKIESCGSTYFWRFKLFLLRILYQAMQKAPSEVTWRPSHED
AKILISDSPGMGSTEDDQEEGTSKQASKQSLRDTGKGVDIDDTADDSLHQSGDTGGREPM
VEKLLEIQAQIEAVEMHLTREHMKRVLGEVYLHTWITENTSIPTRGVCDFLMSDDGYDDR
TARVLIGHILKKMNKQTFPEHCSLCKEILPFTDRKQAVCSNGHIWLRCFLTYQSCQSFVY
RRCLLHDSIARHPTPEDPEWIKRLLQGPCTFCDSPVF
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgcccgctcctccgcaggaccccggggccgcctcccacccggcccggccccctg
gccgtgctggagcagctcagcgacgtgcacagcggcgggcaggacatggtgatccaccgc
accgccgtgcccgcgcccggcaccgcctgcacgctcaaggtcggccccaagaaggaggtg
gctgagtgtaaggagaaatttgccagctcagtggatcccactgtcagccagacgtttatg
ctggaccgagtgttcaaccccgaggggaagtccctgacacccatgcggggcttcaaatat
tccagctggtcccctctgggctgtgacgccaacgggaggtgcctgctggcagccctgacc
atggacaaccgcctgaccatccacgccaacctcaaccggctgcagtgggtgcagctggtg
gacctgaccgagctgtacggcgagcgcctgttcgaggccagctacagactgtcaccggat
tctctgtttacggcggtgcggagagagccggcggtgcggctgcagcacggcgccagcggg
ctggatccgctggcctgttccgaagaccaccgggtgtcggtgagcacggcccgcagcatc
gccgtgctggagcagatcagcgacgtgcacagcggcgggcaggacatggtgatccaccgc
accgccgtgcccgcgcccggcaccgcctgcacgctcaaggggaagcggctgggctcgtcg
aaggaggtggctgagtgtaaggagaaatttgccagctcagtggatcccactgtcagccag
acgtttatgctggaccgagtgttcaaccccgaggggaagtccctgacacccatgcggggc
ttcaaatattccagctggtcccctctgggctgtgacgccaacgggaggtgcctgctggca
gccctgaccatggacaaccgcctgaccatccacgccaacctcaaccggctgcagtgggtg
cagctggtggacctgaccgagctgtacggcgagcgcctgttcgaggccagctacagactg
tgtaaggctgacgctccctgcggggagctgggagacttcccggagttccagcggcggcac
agcatgcaggccccggtgcgcatggagtggtcgggcatctgcaccacccagcaggtcaag
cacaacaacgagtgccgcgacgtgggcagcgtgctcctggccgtgctcttcgagaacggc
aacatcgccgtctggcagttccagctgccctttctggggaaggaatccatcacttcctgc
aataccatcgagtcgggaataagctctcccagcgtgttgtcctggtgggagtacgagcac
aacaaccggaagatgagcgggctgatcgtgggcagcgcgtacggcccggtgaagatcatc
cctgtcaacctcaaggcggtcaaaggctacttcacgctgagacagcccgtggtcttgtgg
caggagatggaccagctgcccgtgcacagcatcaaatgcatccctctctaccacccctac
cagaaatgcagctgcagcctggtggtggctgcgagaggcccttacgtgttctggtgcctc
ctgctgatatccaaagcggggctgaacgtccacaattcccacgtcacagggctgcactcc
ttgcccattgtctccatgactgcagacaagcagaacggcacggtgtatacctgctccagc
gatggcaaggtcaggcagctcatccccatattcacagacgttgctttaaagtttgagcac
caggtgataaagctctcggaggtgtttggctgtgtcagaactcacggaatcgccgtcagc
ccgtgtggggcgtacctggcggtcatcaccaccgagggcatggccaacgggctgcacccg
gtcaacaaaaactaccaagttcagtttgtcaccctcaagacttttgaggaggcagctgca
cagctcttggaatcttctgttcagaaccttttccggcaagtggacttgaccgatctcgta
cgttggaaaatcttgaaggataagcacatccctcagttcttacaggaagcactggataaa
aagatagagagctgcggttccacttacttctggaggtttaagttgtttctcttgaggatt
ttgtaccaggcgatgcagaaagccccctcagaggtcacgtggagaccttcacacgaggat
gccaaaatcttgatatcagattcccctgggatgggcagcactgaagatgatcaagaggaa
ggaacttcgaaacaagccagcaagcagagcctgagggacacaggcaaaggtgtggacatt
gatgacactgcagatgactctctccatcagtcaggtgacactggaggccgtgagccaatg
gtagaaaagcttcttgaaatacaggcacagattgaggctgtagaaatgcacttgacccga
gaacacatgaaacgggtgttgggagaagtttacctgcacacgtggattacagagaacacc
agcattcccaccagaggagtctgtgacttcttaatgtctgacgatggctacgatgacaga
acagcacgagtgctgattgggcacatcctgaagaagatgaacaagcaaaccttccccgag
cactgcagtttgtgcaaggagatcctgcccttcaccgaccgcaagcaggcagtctgctcc
aacggccacatttggctcaggtgctttctaacctaccagtcctgccagagttttgtgtac
aggaggtgtttgcttcacgacagcattgcacggcacccgaccccagaagaccctgaatgg
atcaagaggttgttgcagggaccttgcaccttctgtgattctcctgtgttctag

DBGET integrated database retrieval system