KEGG   Taeniopygia guttata (zebra finch): 100229190Help
Entry
100229190         CDS       T01082                                 

Gene name
ST3GAL5
Definition
ST3 beta-galactoside alpha-2,3-sialyltransferase 5
Orthology
K03370  
lactosylceramide alpha-2,3-sialyltransferase (sialyltransferase 9) [EC:2.4.99.9]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Module
Glycosphingolipid biosynthesis, ganglio series, LacCer => GT3
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    100229190 (ST3GAL5)
Enzymes [BR:tgu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.9  lactosylceramide alpha-2,3-sialyltransferase
     100229190 (ST3GAL5)
Glycosyltransferases [BR:tgu01003]
 Terminal extension
  Sialyltransferase
   100229190 (ST3GAL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 370 aa AA seqDB search
MKMRRPSWFLKGTRKVLALFVVGGCFLYILKLHLDPEECDRTKMPYVDLDRVRRAQQFTS
AALQEQCRPSYAKKEMRKLFAEKYNMDISPFVRKNMNEDEALFKYEPPFGFHKFSDKLKD
LLELLPEHDLPEDLKSKHCKRCVVVGSGGILHGSELGHLLNQFDIVIRLNDAPVQGYTDH
VGNKTTIRMTYPEGAPLSEHEYPPASLFVAVLFKGVDFNWLQAMVKNETLHLWVRLFFWK
QVAEKIPFTPKQFRILNPVIIKETALDILHFPEPRSKFWGWDKNVPTIGVTAVVLATHLC
DEVSLAGFGYDLDQPSTPLHYYNNLCMAAMKEQTMHNVTSETKFLQKLIKEKIVKDLTGG
IYCEFCSKDS
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgagaagaccaagctggtttttaaaaggtactcgcaaagttcttgcactattt
gtggttggagggtgcttcctttatatcctcaaattacatcttgaccctgaggaatgtgac
agaacaaaaatgccgtatgtggacctcgatcgtgtaaggagggcacagcaattcaccagc
gctgcgctgcaggagcagtgccgaccttcttatgcgaagaaagagatgaggaagctgttt
gcagagaaatacaacatggacatatctccctttgtaaggaaaaatatgaacgaagatgaa
gctttatttaaatatgaacccccatttggatttcacaagttctctgataaacttaaagat
ctccttgaactcttacctgagcacgatttaccagaagatttgaagtcaaagcactgtaag
cgctgtgttgttgttggcagtggtggaattcttcatggatcagagctgggtcacttactg
aatcagtttgatattgttataaggttaaatgatgcaccagttcaaggctacacggatcat
gttggtaacaaaacaacaatacggatgacttaccctgaaggagcccccctttctgagcat
gagtatcctcctgcaagcttgtttgtggctgttctgtttaaaggagttgatttcaactgg
cttcaagccatggtaaaaaatgaaaccttgcatctgtgggtacgactcttcttttggaag
caggttgctgaaaaaattcctttcacaccaaagcagtttcggattctgaatccagtcatt
atcaaagagacagctttggacattttacacttccctgagcctcgatcaaaattctggggt
tgggataagaatgtgcctacaattggggtcacagcagttgttctggccacacatttatgt
gatgaagtgagcttagcaggatttggatatgacctggatcagcccagcacacctttgcac
tattacaacaacctctgcatggctgccatgaaagaacaaactatgcacaatgtgacaagt
gaaacaaaattcctgcaaaaactgatcaaagaaaaaattgtcaaggacctcactggaggg
atatactgtgaattctgcagcaaagacagctag

DBGET integrated database retrieval system