KEGG   Taeniopygia guttata (zebra finch): 100229232Help
Entry
100229232         CDS       T01082                                 

Gene name
PIK3CG
Definition
phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit gamma
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Inositol phosphate metabolism
ErbB signaling pathway
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Apoptosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Influenza A
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100229232 (PIK3CG)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    100229232 (PIK3CG)
   04370 VEGF signaling pathway
    100229232 (PIK3CG)
   04630 Jak-STAT signaling pathway
    100229232 (PIK3CG)
   04068 FoxO signaling pathway
    100229232 (PIK3CG)
   04070 Phosphatidylinositol signaling system
    100229232 (PIK3CG)
   04150 mTOR signaling pathway
    100229232 (PIK3CG)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100229232 (PIK3CG)
  Cell growth and death
   04210 Apoptosis
    100229232 (PIK3CG)
  Cellular commiunity
   04510 Focal adhesion
    100229232 (PIK3CG)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100229232 (PIK3CG)
  Endocrine system
   04910 Insulin signaling pathway
    100229232 (PIK3CG)
   04914 Progesterone-mediated oocyte maturation
    100229232 (PIK3CG)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100229232 (PIK3CG)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100229232 (PIK3CG)
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100229232 (PIK3CG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1A
AA seq 1106 aa AA seqDB search
MELGDHEQPVVMRDENKRRRRRMKPHCASSSFSSMELISIEFILPTSNKHTKAPETMLLE
IAGNCTVEQMKAQIWMRAIETSQTTDFYHAFTPDQFILQYQKKGQWYEIYDKHQVLQTLD
CILYWKVLQKKVGKIYVVQKQTPSEEVQELQRQLNDLIGYDVTDVSNVHDDELEFTRRRL
VTPRMIEVACRDPKLYAMHPWTTSKPLPEYLFKKIINNNIFIIIHRGTTSQKIKVSIDDT
PDMILHSFFTKMAKKKSLMDIPEDHSELDFVLRICGRDEYITGDTPIKDFHWIRQCLKNG
EEIHLVLDNPPDPNEDEVQKEEWPLVDDCTGVTGYHEQLTIDGKDHERVFTISLWDCNRK
FRVKIIGIDIPVLPRNTDLTVFVEANIQHGQQLLSQRRTSSKPFTEEVLWNIWLEFDIKI
KDLPKGALLNLQIYCGKAQGPSAKTNLQSHESSNSDAKCKTQLLYYVNLLLIDHRFLLRS
GEYVLHMWKIPGKGEEQGSINADKLTSATNPDKENSMAISIVLDKYCHPIALPKHRISSD
PQGDRTRAEMPNQLRKQLEEIIATDPLNPLSPEDKELLWHFRYESIKHPKAYPKLLSSVK
WGQQEIVAKTYQLLAKKEAWDQSTLDVGLTMQLLDCNFSDENVRAMAVQKLESLDDDDVL
HYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSMHYQQRFAVIL
EAYLRGCGKAMLHDFMKQVQVIELLHKVTMEIKSVSAEKYDVTSQVIAQLRQKLEKLQGS
KLPESFRVPYDPGLRAGALVIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDD
LRQDMLILQILRIMESIWEAESLDLCLLPYGCISTGNKIGMIEIVKDATTIAKIQQSTVG
NTGAFKDEILNQWLKERCMIEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITET
GNLFHIDFGHILGNYKSFLGINKERVPFVLTPDFLYVMGTSGKKTSLHFHKFQDVCVKAY
LALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKSEEDAKKHFLDQIEVCRD
KGWTVQFNWFLHLVLGIKQGVEKHSA
NT seq 3321 nt NT seq  +upstreamnt  +downstreamnt
atggagttgggggatcatgaacagcctgttgttatgagagacgaaaacaaacgaaggaga
agaagaatgaaacctcattgtgcatcgagtagtttttcatccatggaactgatatctatt
gagttcattttacctacaagcaataaacatactaaagccccagagactatgttacttgaa
atagctggcaactgtacggttgagcaaatgaaagcacagatttggatgcgtgcaatagag
acaagtcaaaccacagacttctaccatgcattcaccccagatcagtttattctgcagtat
cagaagaaagggcaatggtatgaaatttatgataaacatcaagtattacagacattggac
tgcatactttactggaaggtgttgcagaaaaaggtaggcaaaatctatgttgtccagaaa
caaacaccatccgaagaagttcaggaattgcagcggcaacttaatgatttgattggttat
gatgtcactgatgtaagcaatgtgcacgatgatgaactagaatttacccggcgcagatta
gtcactccacgaatgatagaggtagcctgcagagatcctaaattatatgcaatgcaccca
tggactacatctaagccactcccagaatatttatttaaaaagatcattaataataatatt
ttcataatcatacatagaggaacaactagtcagaaaattaaagtgtcaatagatgacact
ccagatatgattctccacagctttttcacaaaaatggcaaagaaaaagtctttgatggac
attcctgaagatcacagtgaactggattttgttctcaggatttgtggtagagatgagtac
attactggagacacaccaatcaaagattttcactggataagacagtgccttaagaatggg
gaagaaatccaccttgtccttgacaatcccccagacccgaatgaagatgaggttcagaag
gaagaatggcccttggtggatgactgtacaggagttacagggtatcatgaacaattgaca
atagatggaaaagatcatgaaagggtcttcactatctctttgtgggattgtaataggaaa
tttagagtgaaaataattggcattgatatcccagttttaccaagaaatactgatctcacc
gtgtttgtagaggctaacattcaacatgggcagcagctactttcacagagaagaacttca
tcaaagccttttactgaggaggttctgtggaatatttggttggaatttgatataaaaatc
aaggatttgcctaaaggagcacttctcaatcttcagatatactgtggcaaagcacagggg
ccatctgcaaagacaaaccttcagtctcatgaatcctctaactctgacgcaaaatgcaaa
acccagcttctatattatgtaaatcttttgttgatagatcaccgtttcttgctacgaagt
ggagagtatgtactccacatgtggaaaattccaggtaagggggaagaacaaggaagtatc
aatgcagacaaactcacatcagcaactaacccggataaagaaaactcaatggctatctct
attgtgctggacaaatattgtcacccaattgccttgcccaagcacaggatatcatcagac
ccccagggggacaggactcgagctgaaatgcccaaccagcttcgcaagcaacttgaagag
atcatagcaactgacccacttaatccactttctcccgaggacaaagaactgttgtggcac
tttagatatgagagcataaagcaccccaaggcatatcctaagctgcttagctctgtgaaa
tggggacaacaagaaatagtggccaaaacataccagttgctagctaaaaaagaggcttgg
gatcagagcactttagatgttggactcacaatgcaacttctggactgtaacttttcagac
gaaaatgtccgagcaatggcagttcaaaaactggaaagtttagatgatgatgatgttctt
cattaccttttacagcttgtgcaggctgtgaaatttgagccatatcatgacagcgcatta
gccagatttttgctgaaacgtggtttgagaaacaaaagaattggtcacttcttgttttgg
ttcttaagaagcgaaattgcccagtccatgcactaccaacagagatttgcagtcatcctt
gaagcctaccttaggggctgtggaaaagcaatgctgcacgatttcatgaagcaagttcaa
gtaattgaattgctgcataaagtcacaatggagattaaatcagtttctgcagaaaagtat
gatgttacttctcaagttattgcacaactgagacaaaagcttgaaaaattgcagggcagc
aaacttccagaaagttttagagttccatatgatcctggactaagagcaggagcactagtg
atagaaaaatgtaaagtaatggcgtccaagaagaagcccctctggcttgaatttaaatgt
gcagatccaacagctctgtcaaatgaaaccataggcatcatcttcaaacatggagatgac
ctccgtcaggacatgctaattttacagattcttagaattatggaatccatttgggaagca
gaatccttggacctctgtttgttgccatatggttgcatttctacagggaacaaaatagga
atgatcgaaattgtgaaagatgctacaacaattgccaaaattcaacagagtacagttggg
aacactggtgcatttaaggatgaaatactaaaccagtggctcaaggaaaggtgcatgatt
gaagagaagtttcaggcagctgtggaaagatttgtttattcttgtgctggatactgtgtg
gcaacctttgtacttggaataggagacaggcacaatgacaacatcatgattacagaaaca
ggtaaccttttccatattgattttggacatattcttgggaattataaaagcttccttgga
attaacaaggagagagttccttttgtgctgactccagattttctgtatgttatgggaact
tctggaaagaagacaagtctccatttccacaaatttcaggatgtatgtgtgaaggcttat
ttagctctccgacaccacacaaacctgctgatcatcctgttctccatgatgctgatgact
ggaatgccccaattaaccagcaaagaagatattgaatatatcagggatgcactgacagta
gggaagagtgaagaagatgccaaaaagcattttcttgatcagatagaggtttgcagagat
aagggctggacagtgcagtttaactggtttttgcatcttgtgcttggaatcaaacaagga
gtagaaaagcattctgcttaa

DBGET integrated database retrieval system