KEGG   Taeniopygia guttata (zebra finch): 100229323Help
Entry
100229323         CDS       T01082                                 

Gene name
PLCD1
Definition
(RefSeq) phospholipase C delta 1
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00562  Inositol phosphate metabolism
tgu01100  Metabolic pathways
tgu04020  Calcium signaling pathway
tgu04070  Phosphatidylinositol signaling system
tgu04933  AGE-RAGE signaling pathway in diabetic complications
Module
tgu_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100229323 (PLCD1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100229323 (PLCD1)
   04070 Phosphatidylinositol signaling system
    100229323 (PLCD1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100229323 (PLCD1)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100229323 (PLCD1)
Membrane trafficking [BR:tgu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100229323 (PLCD1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100229323 (PLCD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like EF-hand_10 C2 PH_12 PH EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5
Motif
Other DBs
NCBI-GeneID: 100229323
NCBI-ProteinID: XP_002196645
Ensembl: ENSTGUG00000000391
Position
2
AA seq 779 aa AA seqDB search
MQCIRRQPKRTVSQENILLEQSRRVAALNGIRLGLKDDKDLKFLLKGSQLLKVKSSSWRK
ERFYKLQEDCKTIWQESKKVLRSPESQIFSIEDIRDVRSGHKTEGMEKYAKDVPEYRCFS
IIFKDQRKNLDLIASSEDDANHWIAGLGKIIAHSNSMNQKQKLQHWIHTCLRKADKNKDN
KMSLKELKDFLKEVNIEVDDYHAKKIFQHCDKSKTEALEDDEIEEFYKILTERKEIDSIF
QMYSNPEGFMSCQNLVRFLYEVQQEEDAVIAAPALIQRYEPNERAKRGNAMTKDGFLMYL
LSDEGNIFNPSHRKVYQDMTQPLSHYLVSSSHNTYLMEDQITGPSSTEAYIRALTKGCRC
VELDCWDGPNSEPVIYHGYTLTSKILFSDVIKAIKNYAFKTSPYPVIISLENHCSVEQQK
VMAQHMTTILQDMLLVAPVDGNKSQFPSPEQLKGKILVKGKKLSRQEDPINGNNNLEAED
VSDEDEAAEIEDESVKTKVEQKGKSDTLKLAKELSDTVVYCKSVHFEGFDDPNHPRAFYE
MSSFSESKALKLAQESGTSFIHHNIRHLSRIYPAGWRTDSSNYSPVELWNVGCQIVALNF
QTAGTEMDVYQGRFQDNGFSGYVLKPEFLRDEQTKFNPKSITEGTWGTKKKLLLKIISGQ
QLPKVNKSKNSIVDPKVTIEIHGVQQDNNKKQTKVIENNGFNPNWNEEFTFDIEIPALAL
VRFVVEDFDMSTKNDFIGQYTLPFTSLKQGYRHIHLLTKNGDPYSSSTLFVYVNIQDCD
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgcatccggaggcagcccaagcgcaccgtgtcccaggagaacatcctgctggag
cagagccgtagggtggcggcgctgaatggcatcaggctgggcctcaaagatgacaaggac
ctgaagttcctcctgaaaggcagccagctgctgaaagtgaagtcaagctcctggagaaag
gagcggttctataagctccaggaggactgcaaaaccatatggcaggagtcaaagaaggtg
ctgagatccccagagtcacagatcttctccattgaagatatccgggatgtgaggtcaggc
cataaaacagaaggtatggaaaaatacgccaaggatgtcccagagtatcgctgcttttcc
atcatcttcaaagaccagcggaaaaacctggacctcattgcgagttcagaggacgatgcc
aaccactggattgctggccttgggaaaatcatagcccacagcaactccatgaaccagaaa
cagaaactccaacactggattcacacctgcctgaggaaagctgacaaaaacaaagacaac
aagatgagcctgaaagagctcaaagactttctgaaagaagtgaacattgaagtcgatgac
taccatgccaagaagattttccagcactgtgacaagtccaaaacagaggctctggaggat
gatgagatagaggaattttacaagattctgacagaaaggaaggaaatagacagcatcttc
caaatgtactcgaacccagaagggttcatgtcctgccagaacctggtgaggtttctctat
gaggtgcagcaggaagaagatgctgttattgctgcccctgccttaattcagagatatgag
cccaacgaaagagccaagaggggcaacgccatgaccaaggatggtttcctgatgtacctg
ctgtcagatgaggggaacatattcaacccctcccaccggaaagtttaccaggacatgacc
caacctctcagtcactacttggtgtcatcctcacacaacacctatctcatggaagaccag
atcacagggccaagcagcacagaggcctatatcagagccctgaccaaaggctgtcgctgt
gtggagctggattgctgggatggccccaactcagagcccgtcatttatcacggctacact
ctcacctccaagatcctcttcagcgatgtcattaaggccatcaagaactatgcattcaaa
acctcaccataccccgtcatcatctccctggagaaccactgcagcgtggagcagcagaag
gtcatggcccagcacatgaccaccatcctgcaggacatgctcttggttgccccagtcgat
ggaaacaaatcccagttcccctccccagagcaattgaaagggaagatcctggtgaaaggc
aagaagctgagcaggcaggaggaccccatcaatgggaacaacaacctggaggctgaggat
gtctctgatgaagatgaagcagctgaaattgaagatgaatctgtgaagaccaaggtagag
cagaagggaaagagtgacaccttgaagctggccaaggagctgtcagacacagttgtctac
tgtaagagtgtccactttgaaggctttgatgaccccaaccatcctcgggctttctacgag
atgtcgtcgttctcggagagcaaagctctgaaactggcccaggagtctggaaccagtttt
attcaccacaacatcaggcacctgagccgtatctaccctgcaggctggaggacggattct
tccaactacagccccgtggagctgtggaacgtcggctgccagatcgttgccctaaatttc
cagacagcaggcacagaaatggatgtgtaccagggtcggttccaggacaatgggttttct
gggtatgtcttaaagccggaattcctccgggatgaacaaaccaaattcaatccaaaatcc
atcacagaaggaacatgggggacaaagaagaagctgctgcttaaaataatctctggtcag
cagctgccaaaggtgaacaaaagcaaaaactccattgtggatcccaaggtaacaatagag
atccacggtgtccagcaggacaacaacaagaagcagaccaaagtcatcgaaaacaatggc
tttaacccaaactggaatgaagagtttacatttgacatagagatccctgcactcgccttg
gtccggtttgtggtggaagattttgacatgtcgaccaagaatgacttcatcgggcagtac
acccttcccttcacgagtctgaagcaaggttatcgccacatccatctcctgaccaagaat
ggagacccgtactcctcctccaccctctttgtctacgtcaatatccaggactgtgattag

DBGET integrated database retrieval system