KEGG   Taeniopygia guttata (zebra finch): 100229323Help
Entry
100229323         CDS       T01082                                 

Gene name
PLCD1
Definition
phospholipase C, delta 1
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100229323 (PLCD1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100229323 (PLCD1)
   04070 Phosphatidylinositol signaling system
    100229323 (PLCD1)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100229323 (PLCD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 779 aa AA seqDB search
MQCIRRQPKRTVSQENILLEQSRRVAALNGIRLGLKDDKDLKFLLKGSQLLKVKSSSWRK
ERFYKLQEDCKTIWQESKKVLRSPESQIFSIEDIRDVRSGHKTEGMEKYAKDVPEYRCFS
IIFKDQRKNLDLIASSEDDANHWIAGLGKIIAHSNSMNQKQKLQHWIHTCLRKADKNKDN
KMSLKELKDFLKEVNIEVDDYHAKKIFQHCDKSKTEALEDDEIEEFYKILTERKEIDSIF
QMYSNPEGFMSCQNLVRFLYEVQQEEDAVIAAPALIQRYEPNERAKRGNAMTKDGFLMYL
LSDEGNIFNPSHRKVYQDMTQPLSHYLVSSSHNTYLMEDQITGPSSTEAYIRALTKGCRC
VELDCWDGPNSEPVIYHGYTLTSKILFSDVIKAIKNYAFKTSPYPVIISLENHCSVEQQK
VMAQHMTTILQDMLLVAPVDGNKSQFPSPEQLKGKILVKGKKLSRQEDPINGNNNLEAED
VSDEDEAAEIEDESVKTKVEQKGKSDTLKLAKELSDTVVYCKSVHFEGFDDPNHPRAFYE
MSSFSESKALKLAQESGTSFIHHNIRHLSRIYPAGWRTDSSNYSPVELWNVGCQIVALNF
QTAGTEMDVYQGRFQDNGFSGYVLKPEFLRDEQTKFNPKSITEGTWGTKKKLLLKIISGQ
QLPKVNKSKNSIVDPKVTIEIHGVQQDNNKKQTKVIENNGFNPNWNEEFTFDIEIPALAL
VRFVVEDFDMSTKNDFIGQYTLPFTSLKQGYRHIHLLTKNGDPYSSSTLFVYVNIQDCD
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgcatccggaggcagcccaagcgcaccgtgtcccaggagaacatcctgctggag
cagagccgtagggtggcggcgctgaatggcatcaggctgggcctcaaagatgacaaggac
ctgaagttcctcctgaaaggcagccagctgctgaaagtgaagtcaagctcctggagaaag
gagcggttctataagctccaggaggactgcaaaaccatatggcaggagtcaaagaaggtg
ctgagatccccagagtcacagatcttctccattgaagatatccgggatgtgaggtcaggc
cataaaacagaaggtatggaaaaatacgccaaggatgtcccagagtatcgctgcttttcc
atcatcttcaaagaccagcggaaaaacctggacctcattgcgagttcagaggacgatgcc
aaccactggattgctggccttgggaaaatcatagcccacagcaactccatgaaccagaaa
cagaaactccaacactggattcacacctgcctgaggaaagctgacaaaaacaaagacaac
aagatgagcctgaaagagctcaaagactttctgaaagaagtgaacattgaagtcgatgac
taccatgccaagaagattttccagcactgtgacaagtccaaaacagaggctctggaggat
gatgagatagaggaattttacaagattctgacagaaaggaaggaaatagacagcatcttc
caaatgtactcgaacccagaagggttcatgtcctgccagaacctggtgaggtttctctat
gaggtgcagcaggaagaagatgctgttattgctgcccctgccttaattcagagatatgag
cccaacgaaagagccaagaggggcaacgccatgaccaaggatggtttcctgatgtacctg
ctgtcagatgaggggaacatattcaacccctcccaccggaaagtttaccaggacatgacc
caacctctcagtcactacttggtgtcatcctcacacaacacctatctcatggaagaccag
atcacagggccaagcagcacagaggcctatatcagagccctgaccaaaggctgtcgctgt
gtggagctggattgctgggatggccccaactcagagcccgtcatttatcacggctacact
ctcacctccaagatcctcttcagcgatgtcattaaggccatcaagaactatgcattcaaa
acctcaccataccccgtcatcatctccctggagaaccactgcagcgtggagcagcagaag
gtcatggcccagcacatgaccaccatcctgcaggacatgctcttggttgccccagtcgat
ggaaacaaatcccagttcccctccccagagcaattgaaagggaagatcctggtgaaaggc
aagaagctgagcaggcaggaggaccccatcaatgggaacaacaacctggaggctgaggat
gtctctgatgaagatgaagcagctgaaattgaagatgaatctgtgaagaccaaggtagag
cagaagggaaagagtgacaccttgaagctggccaaggagctgtcagacacagttgtctac
tgtaagagtgtccactttgaaggctttgatgaccccaaccatcctcgggctttctacgag
atgtcgtcgttctcggagagcaaagctctgaaactggcccaggagtctggaaccagtttt
attcaccacaacatcaggcacctgagccgtatctaccctgcaggctggaggacggattct
tccaactacagccccgtggagctgtggaacgtcggctgccagatcgttgccctaaatttc
cagacagcaggcacagaaatggatgtgtaccagggtcggttccaggacaatgggttttct
gggtatgtcttaaagccggaattcctccgggatgaacaaaccaaattcaatccaaaatcc
atcacagaaggaacatgggggacaaagaagaagctgctgcttaaaataatctctggtcag
cagctgccaaaggtgaacaaaagcaaaaactccattgtggatcccaaggtaacaatagag
atccacggtgtccagcaggacaacaacaagaagcagaccaaagtcatcgaaaacaatggc
tttaacccaaactggaatgaagagtttacatttgacatagagatccctgcactcgccttg
gtccggtttgtggtggaagattttgacatgtcgaccaagaatgacttcatcgggcagtac
acccttcccttcacgagtctgaagcaaggttatcgccacatccatctcctgaccaagaat
ggagacccgtactcctcctccaccctctttgtctacgtcaatatccaggactgtgattag

DBGET integrated database retrieval system