KEGG   Taeniopygia guttata (zebra finch): 100229323Help
Entry
100229323         CDS       T01082                                 

Gene name
PLCD1
Definition
(RefSeq) phospholipase C delta 1
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100229323 (PLCD1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100229323 (PLCD1)
   04070 Phosphatidylinositol signaling system
    100229323 (PLCD1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100229323 (PLCD1)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100229323 (PLCD1)
Membrane trafficking [BR:tgu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100229323 (PLCD1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100229323 (PLCD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 779 aa AA seqDB search
MQCIRRQPKRTVSQENILLEQSRRVAALNGIRLGLKDDKDLKFLLKGSQLLKVKSSSWRK
ERFYKLQEDCKTIWQESKKVLRSPESQIFSIEDIRDVRSGHKTEGMEKYAKDVPEYRCFS
IIFKDQRKNLDLIASSEDDANHWIAGLGKIIAHSNSMNQKQKLQHWIHTCLRKADKNKDN
KMSLKELKDFLKEVNIEVDDYHAKKIFQHCDKSKTEALEDDEIEEFYKILTERKEIDSIF
QMYSNPEGFMSCQNLVRFLYEVQQEEDAVIAAPALIQRYEPNERAKRGNAMTKDGFLMYL
LSDEGNIFNPSHRKVYQDMTQPLSHYLVSSSHNTYLMEDQITGPSSTEAYIRALTKGCRC
VELDCWDGPNSEPVIYHGYTLTSKILFSDVIKAIKNYAFKTSPYPVIISLENHCSVEQQK
VMAQHMTTILQDMLLVAPVDGNKSQFPSPEQLKGKILVKGKKLSRQEDPINGNNNLEAED
VSDEDEAAEIEDESVKTKVEQKGKSDTLKLAKELSDTVVYCKSVHFEGFDDPNHPRAFYE
MSSFSESKALKLAQESGTSFIHHNIRHLSRIYPAGWRTDSSNYSPVELWNVGCQIVALNF
QTAGTEMDVYQGRFQDNGFSGYVLKPEFLRDEQTKFNPKSITEGTWGTKKKLLLKIISGQ
QLPKVNKSKNSIVDPKVTIEIHGVQQDNNKKQTKVIENNGFNPNWNEEFTFDIEIPALAL
VRFVVEDFDMSTKNDFIGQYTLPFTSLKQGYRHIHLLTKNGDPYSSSTLFVYVNIQDCD
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgcatccggaggcagcccaagcgcaccgtgtcccaggagaacatcctgctggag
cagagccgtagggtggcggcgctgaatggcatcaggctgggcctcaaagatgacaaggac
ctgaagttcctcctgaaaggcagccagctgctgaaagtgaagtcaagctcctggagaaag
gagcggttctataagctccaggaggactgcaaaaccatatggcaggagtcaaagaaggtg
ctgagatccccagagtcacagatcttctccattgaagatatccgggatgtgaggtcaggc
cataaaacagaaggtatggaaaaatacgccaaggatgtcccagagtatcgctgcttttcc
atcatcttcaaagaccagcggaaaaacctggacctcattgcgagttcagaggacgatgcc
aaccactggattgctggccttgggaaaatcatagcccacagcaactccatgaaccagaaa
cagaaactccaacactggattcacacctgcctgaggaaagctgacaaaaacaaagacaac
aagatgagcctgaaagagctcaaagactttctgaaagaagtgaacattgaagtcgatgac
taccatgccaagaagattttccagcactgtgacaagtccaaaacagaggctctggaggat
gatgagatagaggaattttacaagattctgacagaaaggaaggaaatagacagcatcttc
caaatgtactcgaacccagaagggttcatgtcctgccagaacctggtgaggtttctctat
gaggtgcagcaggaagaagatgctgttattgctgcccctgccttaattcagagatatgag
cccaacgaaagagccaagaggggcaacgccatgaccaaggatggtttcctgatgtacctg
ctgtcagatgaggggaacatattcaacccctcccaccggaaagtttaccaggacatgacc
caacctctcagtcactacttggtgtcatcctcacacaacacctatctcatggaagaccag
atcacagggccaagcagcacagaggcctatatcagagccctgaccaaaggctgtcgctgt
gtggagctggattgctgggatggccccaactcagagcccgtcatttatcacggctacact
ctcacctccaagatcctcttcagcgatgtcattaaggccatcaagaactatgcattcaaa
acctcaccataccccgtcatcatctccctggagaaccactgcagcgtggagcagcagaag
gtcatggcccagcacatgaccaccatcctgcaggacatgctcttggttgccccagtcgat
ggaaacaaatcccagttcccctccccagagcaattgaaagggaagatcctggtgaaaggc
aagaagctgagcaggcaggaggaccccatcaatgggaacaacaacctggaggctgaggat
gtctctgatgaagatgaagcagctgaaattgaagatgaatctgtgaagaccaaggtagag
cagaagggaaagagtgacaccttgaagctggccaaggagctgtcagacacagttgtctac
tgtaagagtgtccactttgaaggctttgatgaccccaaccatcctcgggctttctacgag
atgtcgtcgttctcggagagcaaagctctgaaactggcccaggagtctggaaccagtttt
attcaccacaacatcaggcacctgagccgtatctaccctgcaggctggaggacggattct
tccaactacagccccgtggagctgtggaacgtcggctgccagatcgttgccctaaatttc
cagacagcaggcacagaaatggatgtgtaccagggtcggttccaggacaatgggttttct
gggtatgtcttaaagccggaattcctccgggatgaacaaaccaaattcaatccaaaatcc
atcacagaaggaacatgggggacaaagaagaagctgctgcttaaaataatctctggtcag
cagctgccaaaggtgaacaaaagcaaaaactccattgtggatcccaaggtaacaatagag
atccacggtgtccagcaggacaacaacaagaagcagaccaaagtcatcgaaaacaatggc
tttaacccaaactggaatgaagagtttacatttgacatagagatccctgcactcgccttg
gtccggtttgtggtggaagattttgacatgtcgaccaagaatgacttcatcgggcagtac
acccttcccttcacgagtctgaagcaaggttatcgccacatccatctcctgaccaagaat
ggagacccgtactcctcctccaccctctttgtctacgtcaatatccaggactgtgattag

DBGET integrated database retrieval system