KEGG   Taeniopygia guttata (zebra finch): 100229337Help
Entry
100229337         CDS       T01082                                 

Definition
agmatinase, mitochondrial-like
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    100229337
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     100229337
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 193 aa AA seqDB search
GDHTITYPILQALVAKHGAVGLVHVDAHTDTGDVALGEKIYHGSPFRRCVEEGLLDRGRV
VQIGIRGSSYDPDPLRYCREQGFRVVPAEQCWMKSLQPLMREVRAQMGDKPMYISFDIDG
LDPAYAPGTGTPEIAGLTPAQALEIIRGCKGLNIVGCDLVEVAPMYDVSGNTALLGANLL
FEMLCVLPGVKTL
NT seq 584 nt NT seq  +upstreamnt  +downstreamnt
gtggagatcacaccataacatacccaatcctgcaggcgctggtggcaaagcacggtgccg
tgggactggtgcacgtggatgctcacaccgacaccggggacgtggcactgggggagaaga
tctaccacgggagcccgttccggcggtgtgtggaggaagggctgctggaccgcggccgtg
tggtacagatcggcatccgaggctcctcctatgaccccgatcccctccggtactgccggg
agcagggtttccgcgtggtcccagctgagcagtgctggatgaagtccctgcagccgctga
tgagggaggtgagggcgcagatgggggacaagccgatgtacatcagcttcgacatcgatg
ggctggaccccgcctacgccccgggcaccggcaccccggagatcgccgggctcacacctg
cgcaggctttggagattattcgtggctgcaaaggtctgaacatagtggggtgtgaccttg
tggaagtcgcaccaatgtacgatgtctctggcaatacagccctcctgggggcaaacctac
tgtttgagatgctgtgtgtcctcccaggagtgaagacgctgtga

DBGET integrated database retrieval system