KEGG   Taeniopygia guttata (zebra finch): 100229485Help
Entry
100229485         CDS       T01082                                 

Gene name
SYK
Definition
spleen tyrosine kinase
Orthology
K05855  
spleen tyrosine kinase [EC:2.7.10.2]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100229485 (SYK)
Protein kinases [BR:tgu01001]
 Tyrosine protein kinases
  Syk family
   100229485 (SYK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Z
AA seq 612 aa AA seqDB search
MASSTSNPANHLPYFFGNITREDAEEYLMQGGASDGLYLLRQSRNYLGGFTLSLAHGRKV
HHYTIERELSGSYAIAGGKSHASPAELINYHSGEADGLICLLRKPFNRPPGVEPKTGPFE
DLKENLIREYVKQTWNLQGHALEQAIISQKPQLEKLIATTAHEKMPWFHGRISREESEHR
ILIGSKNNGKFLIRERDSNGSYALCLLNDGKVLHYRIDRDKTGKLSIPDGKRFDTLWQLV
EHYSYKPDGLLRVLTIPCPQHGSENDNLGFNTHSSSGTLPKLQSAIGHPPEEAPFNPYVL
QRNRGLAGAERGDQREALPMDTEVYESPYADPDEIKPKNVTLDRKLLTLEEGELGSGNFG
TVKKGFYKMKKGAKPVAVKILKNESNDPAIKDELLREANVMQQLDNPYIVRMIGICEAEA
WMLVMEMAELGPLNKFLQKNRHVTEKNITELVHQVSMGMKYLEENNFVHRDLAARNVLLV
TQHYAKISDFGLSKALSADENYYKAQSHGKWPVKWYAPECMNFYKFSSKSDVWSFGVLMW
EAFSYGQKPYKGMKGGEVAQMIERGERMERPEVCPTEVYSLMKLCWTYNVDDRPGFAAVE
MRLRNYYYDISH
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atggcttccagcacatcaaaccctgctaaccatttgccttacttctttggtaatatcaca
cgtgaagatgctgaggagtatctaatgcagggaggagcaagtgacggactatacctgctc
cgccagagccggaattacctggggggcttcaccctctccttggcccatggaaggaaggtt
caccactatacgattgagagggagctgagtggctcctatgctattgcgggaggcaagtcg
catgccagtcctgctgaactcattaattatcactcaggggaagctgatggccttatctgt
ctgctgagaaaacctttcaaccggccaccaggtgttgaacccaaaacaggacccttcgaa
gatttgaaagagaacctcatcagagaatatgtcaagcagacttggaatttgcaggggcat
gctcttgaacaagctatcattagtcagaagcctcagctggaaaagctgattgccactaca
gcccatgagaagatgccgtggttccacgggaggatctctcgggaggagtcagagcaccgt
atcctcattgggtccaaaaacaatggaaaatttcttatccgagaaagggacagcaatggt
tcctatgccctgtgcctgctgaatgatggaaaagtactgcactatcgtattgacagagat
aagacaggaaagctctccataccagatggaaaaagatttgacaccctttggcagttagtt
gagcattattcatacaaaccagatggattattaagggttcttaccattccttgtccacaa
catggctcagaaaatgataatctaggatttaatactcattcttcttctggaacacttcct
aagcttcagtcagctatcggccacccaccagaagaagcaccttttaatccatatgtgttg
caaaggaacagaggtcttgcaggagcagaaagaggtgatcagagagaggccttacccatg
gatactgaggtctatgaaagtccatatgctgatccagatgaaattaaaccaaaaaatgtc
actcttgacagaaaattgttgactttggaggaaggtgaacttggctctggcaactttggt
actgtaaagaaagggttctataagatgaaaaagggtgccaagcctgtggctgtaaaaatt
ctgaagaatgagagtaatgatccagccataaaggatgagttactgagagaagcaaatgta
atgcagcaactggataacccatatattgtccgaatgataggtatatgtgaagctgaggcc
tggatgttagttatggaaatggctgaacttgggccactgaacaaatttttgcaaaaaaat
agacatgtcacagagaagaatataacagagctggtgcatcaggtttccatggggatgaaa
tacctggaggagaataattttgttcatagggatttggctgcaagaaatgtgctgttagtc
acacaacattatgccaaaattagtgactttggactttctaaagctcttagtgctgatgaa
aattattacaaggcacaaagtcatggaaaatggccagtcaaatggtatgctccagaatgc
atgaatttctacaaattttctagcaaaagtgatgtctggagctttggggttttaatgtgg
gaagctttctcttatggacaaaaaccatataagggaatgaaaggtggtgaagttgcacag
atgattgaaagaggagaacgaatggaacgacctgaagtctgcccaacagaagtctacagt
ctaatgaaattgtgttggacatacaatgttgatgaccggccaggatttgctgcagtcgag
atgagattacgtaactactattacgacatttcccactaa

DBGET integrated database retrieval system