KEGG   Taeniopygia guttata (zebra finch): 100229535Help
Entry
100229535         CDS       T01082                                 

Gene name
PDIA4
Definition
(RefSeq) protein disulfide isomerase family A, member 4
  KO
K09582  
protein disulfide-isomerase A4 [EC:5.3.4.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100229535 (PDIA4)
Enzymes [BR:tgu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100229535 (PDIA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
2
AA seq 707 aa AA seqDB search
MRMRGLWVLVLLLGLAQIALLARGAAAQEEEDGDGGERGQGRAGSACWVPPREAAARPRR
WALRGASPGWRDAAGAGCSSQASCTPSLSRLGRGGVRLLQCCCPASISWEEEVDDDDSVV
KEENGVLVLNDANFDTFTADKDTVLLEFYAPWCGHCKQFAPEYEKIAKTLKENDPPIPVA
KIDATAATSLSSRFDVSGYPTIKILKKGQAVDYDGSRTEDAIVAKVREVSDPNWTPPPEA
TLVLTQDNFDEVVNDADIILVEFYAPWCGHCKRLAPEYEKAAQELSKRTPPIPLAKVDAT
AETELAKKFDVTGYPTLKIFRKGKPYDYSGPREKYGIVDYMIEQAGPPSKQIQATKQVQE
FLKDGDDVIIIGVFSGENDKTYQLYQEAANGLREDYKFHHTFSNEIGKLLKVSPGKLVVM
QPEKFQSKHEPKMHVLNLKDSMDGSEIKEHVLKHALPLVGHRKPSNDAKRYSKRPLVVVY
YSVDFGFDYRVATQYWRSKVLEVAKDFPEYVFAVSDEEDYSSEIKDLGLLESGEDVNAAI
LDEGGKKYAMEPEEFDSDVLRQFVVAFKKGKLKPIVKSQPVPKNNKGPVKVVVGKTFDSI
VMDPKNDVLIEFYAPWCGHCKKLEPEYNELGKKYKNEKNLIIAKMDATANDVTNDHYKVE
GFPTIYFAPKDKKNNPIKFEGGDRDLEHLSKFIEEHATTLSRTKEEL
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgcgcgggctgtgggtgctggtgctgctgctggggctggctcagatcgccctc
ctggcgcggggagcagcggcacaggaggaggaggatggcgacggaggtgagcgcgggcag
ggccgcgccggcagcgcctgctgggtccccccgcgggaggcggcggcgcggccccggcgc
tgggcgctgcggggagcgagcccgggctggcgggacgccgctggagctggatgctcctcg
caggcctcttgcacgccctccttaagccgtttgggaagaggtggagtccggctgctgcag
tgctgctgtccagcctccatctcctgggaggaggaagtggatgatgatgattctgtagtt
aaagaagaaaatggtgtattagtcttgaatgatgcaaactttgacaccttcactgcagac
aaggatactgtgctgctggagttctacgcaccatggtgcgggcactgcaagcagtttgct
cctgagtatgaaaagatagctaaaactctgaaggaaaatgaccctcctattcctgtagcc
aaaatagatgctactgcagccacttcactatcgagtcgttttgatgtcagtggctaccca
accatcaaaatcctgaaaaaaggccaagctgttgactatgatgggtctcggacagaagat
gctattgtggccaaagtcagggaggtttctgatcccaactggacccctccacctgaagct
actctggtattgacccaggataattttgatgaagttgtgaacgatgctgacataatcctg
gtggagttttatgctccatggtgtggacactgcaagaggcttgctccagaatacgagaag
gctgcccaggagctcagcaagcgcacacctcccatccccctggctaaagtcgacgccacg
gctgaaacagagcttgcaaagaagtttgatgttaccggctacccaactctcaaaatcttc
cgcaagggcaaaccttatgactacagtggtccgcgggaaaaatatggtattgtcgactac
atgattgaacaggctggtcctccatccaaacagattcaggctaccaagcaggtacaagaa
tttctgaaggatggggatgatgtcatcatcattggtgtctttagtggagagaatgacaaa
acctatcagctctatcaggaagcagctaatggtttgagagaagattataaattccatcac
accttcagcaacgagattggaaaactactgaaagtttctccaggaaaactggttgtcatg
cagccagaaaaatttcagtcgaagcacgagcccaagatgcatgttctgaatcttaaagac
tctatggatggatctgagattaaagagcacgtgctaaaacatgctttgcctctagttggt
catcgcaagccttccaacgatgccaagagatactccaagcgtcctttagtggttgtctac
tactccgtggacttcggtttcgactaccgtgttgctactcagtactggaggagcaaagtc
ctggaagtggctaaagacttccctgaatacgtgtttgctgtttctgatgaggaagattat
tcttccgaaataaaagatttgggtctgcttgagagtggagaggatgtcaatgctgccatt
ctggatgaaggtggcaagaagtacgccatggagccagaagagtttgactctgacgtgctc
aggcagttcgtggtggcgttcaaaaaaggaaaactgaagccaattgtgaagtcccagcca
gtgccaaaaaataacaaagggcctgtaaaagtggtagtgggtaaaacttttgattccata
gtgatggatccaaagaatgatgttctcatagagttctatgccccatggtgtggacactgc
aagaaactagaaccagagtataatgagctaggcaaaaaatacaagaatgagaaaaatctg
attatagccaagatggatgctactgccaacgacgtgacgaatgaccactacaaagtggag
ggattccccacaatctactttgctccaaaggacaagaagaacaacccgattaaatttgaa
ggcggggacagagatttagagcatttgagcaaatttatagaggagcatgcaacaacactc
tccagaacaaaagaagagctttag

DBGET integrated database retrieval system