KEGG   Taeniopygia guttata (zebra finch): 100229569Help
Entry
100229569         CDS       T01082                                 

Definition
acetyl-coenzyme A synthetase 2-like, mitochondrial-like
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tgu01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tgu00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tgu00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tgu00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 603 aa AA seqDB search
MPPGWAGGDPRSEVSPSPVFGGENEDFVNCLDQHVEKSPNRVALIWERDEPGTAVHVTYR
ELQDLTCRLANTLKKYGIQKGDRVAIYMSVSPLSVAAMLACARIGAVHTVVFAGFSAESL
AGRIMDSGCKAVITYNQGVRGGRTIELKATVDEAVKNCPSIKHVFVAQRTDNKVQMGDLD
IPLEEEMTKADSVCTPESMDSEDILFMLYTSGSTGKPKGIVHTQAGYLLYAALTHKYVFD
YQQGDVFGCVADIGWITGHSYVVYGPLCNGATSVLFESTPVYPDPGRYWEVVQRLKINQF
YGAPTAIRLLLNYGEEWVKKYDRSSLKVLGSVGEPINKEAWQWFYEVVGEGRCTLVDTWW
QTETGGICIAPRPSEEKAEIVPAMAMRPFFGIVPVLMDENGEVIEGNDVSGALCIAQPWP
GMARTIHGDHQRFIDAYFKAYPGYYFTGDGAYRSQKGYYQITGRMDDVINISGHRLGTAE
IEDAMADHPEVPETAVVGYPHKIKGEGAFAFIVLKEQTACVDHIKEELKTIVASKIAKYA
VPDHILVVKRLPKTRSGKIMRRLLRKVVTEQSSNMGDVTTLDDPSVVKEILDAYQKYKEK
SSS
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgggctgggcgggaggcgacccgcggagcgaagtttctccatcgcccgtcttt
gggggagaaaacgaggatttcgtaaattgcttggatcagcacgtcgaaaagtctccaaac
agagtggctttgatttgggagagagatgaacctggcactgcagtgcatgtcacatacagg
gaacttcaggatctgacttgccgccttgccaacactctgaagaaatatgggatccagaaa
ggggacagggtggccatctatatgtctgtgtcccccttgtcagtggcagccatgctggct
tgtgccaggatcggtgctgttcacaccgtggtcttcgctggattcagcgccgagtccttg
gctgggagaatcatggactctggatgcaaagcagttatcacatacaaccagggagtcagg
ggaggccgaaccatagagctgaaggcaacagtggatgaagctgtgaagaactgtccaagc
atcaaacatgtgtttgtggctcagaggacagataacaaagtccagatgggtgaccttgat
attccccttgaagaggagatgaccaaggcagattccgtgtgcactccagagagcatggac
agtgaagacattctcttcatgctgtacacctcgggcagcactgggaaacccaaaggaatt
gttcacacccaggctggatacctgctctatgctgctctcacacacaagtatgtgtttgac
taccagcaaggagatgtttttggctgtgtggccgacattggctggatcacaggacacagc
tatgttgtgtatggaccactctgcaatggagccacctctgtcctgtttgaaagcactcca
gtgtaccctgacccaggtcgttactgggaagtggtgcaaaggttgaaaattaatcagttc
tacggagcacctacagcgatacgcctgctgctgaattatggagaagagtgggtgaagaaa
tatgacagatcttccttgaaggttttgggttcagtgggagagcccatcaacaaggaagct
tggcagtggttctacgaggtggtgggagaagggcgctgtaccctcgtggacacgtggtgg
cagacagaaacaggtggcatctgcattgccccacggccctcagaggagaaagctgagatt
gttccagctatggctatgagacctttctttgggattgtgcctgtgctcatggatgagaac
ggagaggttatagagggcaatgacgtgtctggtgcactctgcattgcccagccatggcct
ggcatggcaagaacaatccatggagatcaccagcgctttattgatgcctatttcaaagcc
tacccaggatactacttcacaggggacggtgcttacaggagccagaaaggctattaccag
ataacagggcgcatggacgatgtcattaacataagtggacacaggctggggacggcagaa
attgaagatgcaatggctgatcaccctgaggtccctgagacagctgtggttgggtatcca
cataagatcaaaggagaaggtgcctttgctttcatagtgttaaaggagcagacagcttgt
gtagaccatatcaaagaagagctcaaaactatagtggcttccaagatagcgaagtatgct
gtgcctgaccacatcctggtggtaaagcgcctccctaaaacccgatcggggaagatcatg
agaaggctgctgaggaaagtagtcactgaacaatcaagcaacatgggagatgtcaccaca
cttgatgatccaagtgttgtcaaggagatactggatgcttaccagaaatacaaggagaag
agttcctcatag

DBGET integrated database retrieval system