KEGG   Taeniopygia guttata (zebra finch): 100229676Help
Entry
100229676         CDS       T01082                                 

Definition
acrosin-like
Orthology
K01317  
acrosin [EC:3.4.21.10]
Organism
tgu  Taeniopygia guttata (zebra finch)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 275 aa AA seqDB search
MVSDSIPPDDGMTRIVGGTSAKPGAWPWIVSIQHPWLPGANHWCGGSLITADWVLTAAHC
FDSIKKISILNVVIGATQLTQPGAGAEVRKIKKLHRHENYKRSDISNDIALLELNEPVQC
SSYIQLACVAEPTLRVSELINCWIAGWGATTEGGVAGDSFLSLLTDEDSSDHLQEAKVQL
IDVQLCNSSDWYAGEVHPYNLCAGYPQGLIDTCQGDSGGPLMCQDKNADSWWVVGVTSWG
RGCARAKLPGIYTSTQYFYDWILAQMGLSPFGSAS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggtgtctgactccatacctcctgatgacggcatgacacgcattgtgggtggcacaagt
gccaagccaggggcctggccctggattgtcagcatccagcacccctggttaccaggtgca
aaccattggtgtggaggatccctcatcactgcagattgggtcctcacagcagcccactgc
tttgacagcatcaagaaaattagcatcctgaacgtggtgattggggccacccagttgact
cagcctggtgctggggcagaggtacgcaagattaagaagcttcatcgtcatgaaaactat
aagagaagtgatataagtaatgatattgccttgctggaactgaatgagcctgtccagtgc
agttcttacatccagctggcctgtgtggctgagcccaccctaagagtctccgagctcatc
aactgctggattgctggctggggtgccaccacagaaggaggagttgctggggactcattc
ctttctctgctcacagatgaagactcaagtgatcacctccaggaggccaaggtccagctc
attgatgtccagctctgcaacagcagtgactggtacgcaggggaagtccatccttacaac
ttgtgtgctggatacccacagggcctcatcgacacctgccagggtgacagcggtggtcct
ctcatgtgccaagacaagaatgcagactcctggtgggttgttggagtgaccagctgggga
agaggctgcgccagagcaaagctgcccggaatctacacctccactcagtacttctatgac
tggattctggcccagatggggctgagcccatttggaagtgcttcctga

DBGET integrated database retrieval system