KEGG   Taeniopygia guttata (zebra finch): 100229689Help
Entry
100229689         CDS       T01082                                 

Gene name
ADI1
Definition
acireductone dioxygenase 1
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    100229689 (ADI1)
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     100229689 (ADI1)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     100229689 (ADI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 183 aa AA seqDB search
MVEAWYMDESQEDQRAPHRQRPNRAVSLEQLRRLGVVYRRLDADNYETDLCLKEIRRAEN
YSWMDIVTIQKDKLPNYEEKIKTFYEEHLHLDDEIRYILEGSGYFDVRDKDDKWIRIFME
KGDMITLPAGIYHRFTLDENNYVKAMRLFVGEPVWTAYNRPADDFPARKQYMKFLAEEAH
NGV
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggtggaggcctggtacatggacgagtcccaggaggaccagcgggcgccgcaccggcag
cggcccaaccgcgccgtcagcctggagcagctgcgccgcctcggcgtggtgtaccgcagg
ttggatgctgataactatgagactgatctatgcttgaaagagattcggagagcagaaaat
tattcttggatggatatagtgaccatacaaaaagacaagcttccaaattatgaggaaaag
ataaaaacattttatgaagaacatttacacctcgatgatgaaattcgctacatcttggag
ggatctggctattttgatgttcgagacaaggatgacaaatggattcggattttcatggaa
aaaggagacatgataaccctccctgctggcatatatcaccgatttacactggatgagaac
aattacgtgaaggcaatgaggctgtttgttggagaacccgtctggactgcgtacaacagg
ccggctgatgattttcctgctcggaaacagtacatgaagtttctggctgaagaagcacat
aatggtgtctga

DBGET integrated database retrieval system