KEGG   Taeniopygia guttata (zebra finch): 100229724Help
Entry
100229724         CDS       T01082                                 

Gene name
PLCZ1
Definition
phospholipase C, zeta 1
Orthology
K05861  
phosphatidylinositol phospholipase C, zeta [EC:3.1.4.11]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Oocyte meiosis
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100229724 (PLCZ1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100229724 (PLCZ1)
   04070 Phosphatidylinositol signaling system
    100229724 (PLCZ1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100229724 (PLCZ1)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100229724 (PLCZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1A
AA seq 638 aa AA seqDB search
MDENRWFWNIIQNDFKTGNIDFEGCMRLLEKMQINFDEDHLKHIFKKTLDKHSGDIISMD
DFKAIYRALVHRPEFEELFKAYSMDGNILPDGQLLKFLAKEQFQTEANETTALEIIMKYE
PIDEVRKKKQMSFEGFIRYMNSKECSIFKSQHKSVYQDMTQPLCDYFISSSHNTYLIADQ
LMGPSHLWGYTSALLKGCRCLEIDCWDGNNNEPIVYHGHTLTSKIPFRSVIRVIDKYAFM
SSAYPLVLSLENHCSPKQQEVMAECLKTILGDKLLSTPIGGEVDMTRLPSPEALKFKVLV
KNKKVGTLEQSLLRMGDDYRGEAEELSDSDFQSDDEDTDDTLPLHRTRSPAKRKGDRKSS
IPPQKKPKVKRTKIALVLSDLVVYTKSQKFVSFEHSQQHQQCYENNSIGESQARKLAKIS
AKEFISHTTRFITRIYPKGTRMSSSNYNPVEFWNVGCQMVALNFQTPGTQMELQDGKFLD
NGGCGYVLKPAFLRDRNTTFTPRNVGAYSKPMSLSIRLISGHQLPPSAMSKTNKADPLVQ
IEIYGVPEDQARKKSSVVKSNALCPKWNETFSFNIQVPELAMIRFCVEDEVSLVSNEFLG
QYTLPVMSLNTGYRNIPLISKDGIKLESASLFAHVWYY
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atggatgagaacaggtggttttggaatatcattcagaatgatttcaaaactgggaatatt
gatttcgagggttgcatgaggctgcttgaaaaaatgcaaataaattttgatgaagaccat
ttaaaacatattttcaagaaaacccttgacaaacactcaggagatataattagcatggat
gacttcaaagcaatttatcgagctcttgtacacagacctgaatttgaagaactgttcaag
gcttactcaatggatggcaacattctacctgatggccagctccttaaatttcttgcaaaa
gaacaatttcaaactgaagctaatgaaacaactgccttagaaattattatgaagtatgaa
cccattgatgaagtgaggaagaaaaagcagatgtcatttgaaggatttataaggtacatg
aactcaaaagaatgttcaatatttaaaagccagcacaagagcgtctatcaagatatgacc
cagccattgtgtgactattttatttcatcttctcacaacacctacttgatagctgaccaa
ttaatgggacccagtcatttatggggatataccagtgctctcttaaaaggatgtcgttgc
ctggagattgactgctgggatggcaacaacaatgaacccattgtgtatcatggtcacact
ttaacaagcaaaattccatttcgttctgtaattcgtgtgattgacaagtatgcatttatg
tcatctgcgtatccacttgtactgtctttggagaaccactgcagccctaaacagcaggaa
gtaatggcagagtgcttgaaaactattctaggtgataaacttctttctacaccaattggt
ggtgaagtagatatgactcgactgccttctcctgaggcattaaaattcaaagttctggta
aaaaataaaaaagttggaacacttgagcaaagcctgctcaggatgggtgatgactatcgt
ggtgaggcagaggaattgtctgactctgactttcagtctgatgacgaggacacagatgac
acattgcctcttcatagaaccaggagtcccgccaaaagaaaaggagatcgtaaatcttca
atcccacctcaaaaaaaacccaaggtgaagaggacaaagattgcccttgtattgtcagac
cttgtggtttataccaaatctcagaagtttgtgagctttgagcattctcagcagcatcag
cagtgctatgaaaataattccattggagagagtcaagcacgaaaacttgcaaaaatttca
gcgaaagagtttatttcacatactacgagatttattacaagaatttaccccaagggaaca
agaatgagctcttcaaattataatcctgtagagttctggaatgtagggtgtcaaatggtg
gccttaaacttccaaacaccaggcacacaaatggaattgcaagatggaaaattcctggac
aatggtggttgtggctatgtgctgaaacctgcattcttgagggatcgcaataccacattt
acaccccgaaatgtgggagcatacagcaaaccaatgtctctgtcaataaggctcatcagt
ggccatcagttaccacccagtgccatgtcaaagaccaacaaagctgaccccttggtgcag
atagaaatctatggtgtgccagaggatcaagcaagaaaaaaatctagtgttgtaaaaagc
aatgctttgtgccctaaatggaacgaaactttctctttcaacatccaagtcccagagctg
gcaatgattcgcttctgtgtggaggatgaggtgtctctggtcagcaatgaatttcttggc
cagtacactttacctgtgatgagcctgaatacaggttaccgtaacatcccactgatatcc
aaagatggcatcaagctggaatctgcatcgctgtttgctcatgtctggtactattag

DBGET integrated database retrieval system