KEGG   Taeniopygia guttata (zebra finch): 100229734Help
Entry
100229734         CDS       T01082                                 

Gene name
UGT1A1
Definition
UDP glucuronosyltransferase 1 family, polypeptide A1
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100229734 (UGT1A1)
   00053 Ascorbate and aldarate metabolism
    100229734 (UGT1A1)
   00500 Starch and sucrose metabolism
    100229734 (UGT1A1)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100229734 (UGT1A1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100229734 (UGT1A1)
   00860 Porphyrin and chlorophyll metabolism
    100229734 (UGT1A1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100229734 (UGT1A1)
   00982 Drug metabolism - cytochrome P450
    100229734 (UGT1A1)
   00983 Drug metabolism - other enzymes
    100229734 (UGT1A1)
Enzymes [BR:tgu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100229734 (UGT1A1)
Glycosyltransferases [BR:tgu01003]
 Others
  Hydrophobic molecule
   100229734 (UGT1A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 535 aa AA seqDB search
MALELRASPPVVLLLLSLLGLAAAGKLLVVPVDGSHWLSMQELLVLLQQKGHEVVVVAPE
VSLHIKPSKTIVMKTYPVPFTQEEMDKVFKGSVMDLFKGGPFLERVIRQYQQAKKTSALF
LATCTHLIYNKELLSYLEESRFDAILTDPILPCGAILAKYLSLPSVYFLQQIPCGLEYQA
TQCPNPPSYVPRVFTELTDHMTFLQRVKNMLYDIPNFFLCDVVFQPYAELASEFFKQEFL
QRDVTIQELFSQASVWLMRYDFVFEYPRPIMPNMVYIGGINCLQKKPLSKEFEAMVNASG
EHGIVVFSLGSMVSEIPMKKAMEIAEGLGKVPQMVLWRYTGKAPPNLPKNVKLVKWLPQN
DLLAHPKTRAFITHGGSHGVYEGICNAVPMVLMPLFGDQMDNAKRVESRGAGLTLNILEM
TSNDISNALKAVINDKKYKENIQRLSDLHLDRPIHPLDLAVHWVEFVMRHKGAPHLRPAA
HDLNWVQYHSLDVIAFLAAITLLFLFISFKCCLCCCRCCFCKKGRTGKATKAKSH
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggccctggagctcagagcttctccaccagttgtgcttctgctcctgtccctgctgggt
ctggctgctgctgggaagctcctggtggtgccggtggacgggagccactggctgagcatg
caggaattgctggtcctgctccagcagaagggacacgaggtggttgtggtggcacccgaa
gtctccttgcacatcaaaccctccaagaccattgtgatgaaaacataccctgtgcctttc
actcaggaagagatggacaaagttttcaaagggtcagtaatggatttatttaaaggagga
ccttttctggaaagagttattaggcagtaccaacaggcaaaaaagacctctgctctgttc
ctggccacctgcacacacttaatttacaacaaagagctcctcagctaccttgaggagagc
aggtttgatgccatcctcacagaccctatcctcccctgtggggctatactagccaagtat
ctttccctaccttctgtgtatttcctgcagcaaattccatgtggtttggaatatcaagcc
acccagtgccccaatcccccttcctatgtccccagagtatttacagagcttacagaccac
atgacctttctccagcgggtgaagaacatgctctatgacatcccaaattttttcctctgc
gatgttgtcttccaaccttatgcagaactggcttcagaattcttcaagcaggagttcctg
cagagggatgtaacgatacaggagctgttcagccaagcatcagtttggctgatgagatat
gactttgtttttgagtatccgcgccccatcatgcccaacatggtctatattggaggcatc
aactgtctgcagaagaagccactctcaaaggaatttgaagctatggtgaacgcctctgga
gaacacggcatcgttgtcttctcgctgggctccatggtgtccgagattcccatgaagaaa
gccatggaaattgcggagggcttgggcaaagtccctcagatggtcctctggcgctacaca
ggcaaggcaccccccaacctgcccaagaacgtgaagctcgtcaagtggctgcctcagaac
gacctcctggcccaccccaagactcgtgccttcatcacccacggaggctcccatggtgtt
tatgaaggaatctgcaatgcagtgcccatggtgctgatgcctctgtttggggaccagatg
gacaatgccaagcgagtggagtcccggggagcagggctgaccctgaacatcctggagatg
acttccaacgacatttccaatgccctgaaagcagtgatcaatgacaaaaagtacaaggag
aacatccagcgcctgtctgacctgcacctggacagacccatccaccctctggacctggcc
gtgcactgggtggagtttgtgatgaggcacaagggggcccctcacctgcgccccgccgcc
cacgacctcaactgggtgcagtaccactcactggacgtcatcgccttcctggcagccatc
accctcctcttcctcttcatctccttcaagtgctgcctctgctgctgccgctgctgcttc
tgcaagaagggcaggacggggaaggccaccaaagccaagtcccactag

DBGET integrated database retrieval system