KEGG   Taeniopygia guttata (zebra finch): 100229780Help
Entry
100229780         CDS       T01082                                 

Gene name
PDIA6
Definition
protein disulfide isomerase family A, member 6
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:tgu04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 442 aa AA seqDB search
MSLLVVVGTVSCTLFLAVNGLYSASDDVIELTPTNFNKEVIQSDSLWLVEFYAPWCGHCQ
RLTPEWKKAATALKGVVKVGAVDADKHQSLGGQYGVRGFPTIKIFGANKNKAEDYQGGRT
SDAIVDAALSALRTLVKERLSGRSGGYSSGKQGRESGGGDKKDVIELTDDSFDKNVLNSD
DVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDATVNQRLASQYGIRGFP
TIKIFQKGEDPVDYDGGRTRSDIIARALDLFSDNAPPPELLEIISEDVLKSTCDAHQLCI
ISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPA
MAAVNARKMKFALLKGSFSEQGINEFLRELSVGRGSTAPVGGGAFPKIHSVEPWDGKDGE
LPVEDDIDLSDVDLDDLGKDEL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgcttgtcgttgtaggcacggtgagctgcactttgttcctggcagttaatggt
ttgtattcggccagtgatgatgtgatagagctcacaccaactaacttcaacaaggaggtc
attcagagcgacagcctgtggctcgtggagttctatgccccatggtgtggtcattgtcaa
aggctaactcctgagtggaagaaagcagcaacagctttaaaaggtgtagtgaaagtgggt
gcagtagatgcagataagcatcagtccttgggtggacagtatggagtcagagggtttcca
actatcaagatatttggagccaacaaaaacaaagcagaggattatcagggtggcaggaca
agcgacgctatagttgatgctgctctaagtgctcttcggaccctggtgaaagaacgtctt
agtggcagaagtggaggatacagctctggaaaacagggccgggaaagcggaggtggagat
aagaaggatgtgattgagctgacagatgacagctttgataagaatgtcttaaatagcgac
gatgtgtggatggtggagttttatgccccatggtgtgggcactgcaaaaacctggagcca
gaatgggcagctgctgccactgaggtaaaggagcaaacaaaaggaaaagtaaagctggct
gcagtagatgcaacagtcaatcagaggctggcaagccaatacgggattcgtggatttccc
accattaaaatcttccagaaaggagaagaccctgttgattatgatggtgggagaactaga
tctgatatcattgctcgtgctctggacctgttttctgataatgcaccaccacctgagctc
ctggagataattagtgaggatgttctgaaaagtacctgtgacgctcatcagctctgcatc
atttctgtcctgcctcatattcttgacacaggagcttcaggcagaaattcttacctggat
gtcatgttaaaaatggctgaaaaatacaaaaagaagatgtgggggtggctgtggacagaa
gcaggtgctcaatcagatcttgagagctctctggggattggaggctttgggtatccagca
atggcagctgttaatgctcggaagatgaaatttgcccttctgaaaggatcattcagtgag
caagggattaatgaatttctcagggaactctctgttggtcgtggttctacagcaccagtg
ggtggtggagctttccccaaaattcattcagttgaaccttgggatggcaaagatggtgag
cttccagttgaagatgacattgatctcagtgatgtggatctggatgacttgggtaaagat
gagctgtga

DBGET integrated database retrieval system