KEGG   Taeniopygia guttata (zebra finch): 100229810Help
Entry
100229810         CDS       T01082                                 

Gene name
USP33
Definition
ubiquitin specific peptidase 33
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.4.19.12]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100229810 (USP33)
Peptidases [BR:tgu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100229810 (USP33)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 911 aa AA seqDB search
MSSPSSNCPHLESVGEITKEELIQKSHGTCQDCKVRGPNLWACLENKCTYVGCGESHVDH
STTHSQETKHCLTVNLTTLRVWCYACSKEVFLDRKLGSHSPLPSTRLSHQAQENNVQDFK
IPSNPTLKIPLAAVFDDLDIEVEEDELKTRGLTGLKNIGNTCYMNAALQALSNCPPLTHF
FLDCGGLARTDKKPAICKSYLKLMTELWHKSRPGSVVPTGLFQGIKTVNPMFRGYSQQDA
QEFLRCLMDLLHEELKEPVVELEDAQPMSVEESMEEDKSQSDLSFQPCESCSNCDKTEND
TIFKPVLEDPAETTMLIQDDDNNSVTSKDWQKEKISSNKLKRANSMEDLEKDTNTTSETT
EFLNNQGTVKVQIHSRFSEYMNDVHMNDVSAAQTPSSVEGMNTRLSSSPPKSFPSCSSLA
QVHKKVSTVSSPKRKKRKKYRSVISDIFDGTIISSVQCLTCDRLSVTLETFQDLSLPIPG
KEDLAKLHSASHQTSLVKAGSCGEAYAPQGWIAFFMEYFKRFVVSCVPSWFWGPVVTLQD
CLAAFFARDELKGDNMYSCGRCKKLRNGVKFCKVQKFPEILCIHLKRFRHELMFSTKIGT
HVSFPLEGLDLQPFLAKDSPAQIVTYDLLSVICHHGTASSGHYIAYCRNNLNNLWYEFDD
QSVTEVSESTVQNAEAYVLFYRKSSEEAQRERRRISGLLNMMEPSLLQFYVSRQWLNKFK
TFAEPGPISNNDFLCMHGGVPPHKANFIEDLVVMLPQNIWDNLYSRYGGGPAVNHLYVCH
TCQIESERIEKRRKNELEMFIRLNRAFQEEESPSTFYCISMHWFREWEGFVKGKDSDPPG
PIDNAKIAVTKCGNTVLKQGADSGQISEETWNFLQSIYGGGPEIILRPPVPPVEPDILQT
EEKIELETHGL
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcacccagcagcaattgcccacacctggaatcagttggtgagataacaaaggag
gaattgatacagaaatctcatgggacttgtcaggactgtaaagtcagaggaccaaacctt
tgggcatgcttagagaacaagtgcacgtatgttggctgtggtgaatcccatgttgaccac
agtaccacccattcccaggagacaaagcactgtctaactgtcaaccttactactctccgt
gtttggtgttatgcctgtagtaaggaagtattcctggacagaaaattaggatctcactct
ccgctaccaagtacaagactgtctcaccaagcacaagaaaacaatgtgcaggattttaag
atacccagtaatcccacactgaagattccattagcagctgtatttgatgacttagatata
gaagtggaagaagatgaattgaagaccagaggtctaacaggattaaaaaatattggaaac
acttgttacatgaatgcagctttacaagctctttccaactgcccacctttgacgcacttt
tttcttgactgcgggggcttagcccgaacagataagaaacctgcaatttgtaaaagttac
ctcaagctgatgacagaactctggcacaaaagcaggcctggatctgttgttcctactggt
ttatttcaaggaattaaaactgttaatccaatgtttcgaggctactctcaacaggacgca
caagaatttttgcgttgtctaatggatttgcttcatgaggaacttaaagaaccagttgta
gaactggaagatgcccagcctatgagtgttgaagagagtatggaagaagataagagccag
tcagacttaagctttcagccctgtgaatcctgtagtaactgtgataaaacagaaaatgac
acaattttcaaacctgtcttagaggatcctgcagaaacaaccatgttaattcaggatgat
gataacaactcagtcacatccaaagactggcagaaagaaaaaatatcaagcaacaaactt
aaacgagcaaattctatggaagacttggaaaaagacacaaacaccacttcagagaccact
gaatttttaaataaccaaggaactgtcaaagtacagatacacagcagattctcagaatac
atgaatgatgttcacatgaatgacgtatctgcagcccagacaccgtcatcagttgaaggg
atgaacacacgcttatcgagcagccctccaaaatcattcccgtcatgctcttcactggca
caagtccacaaaaaagtttcaacagtatcttcaccaaaaaggaagaagcgcaagaagtac
aggagtgttatctctgatatatttgatgggactataataagttcagtccagtgcttgacc
tgtgatcggctgtctgtaaccctggagacctttcaggatctgtccttgcctattccaggt
aaggaagatcttgctaaactccattctgcaagtcatcagacatctctagtcaaggcaggg
tcatgtggagaagcatatgccccccagggatggatagccttttttatggaatacttcaaa
aggtttgttgtctcatgtgttcctagctggttttggggtccagttgtaaccttacaagat
tgtcttgctgcctttttcgccagagatgagctcaagggtgataacatgtacagctgtgga
aggtgtaaaaagttaagaaatggagtgaaattctgcaaagtacaaaaatttcctgagatt
ctgtgcattcatctcaaaagatttagacatgaactcatgttttccacaaaaattgggacc
catgtgtcctttcccttggaaggtcttgaccttcagcctttccttgcaaaggacagtcca
gctcaaattgtgacttatgatctcctgtctgtcatctgccaccatggaactgccagcagt
ggacattatatagcttattgtcgcaacaatttaaataacttgtggtatgaatttgatgac
cagagtgtcacagaagtatcagaatccacagtacaaaatgcagaagcttatgttctcttc
tacagaaagagcagtgaagaagcacagagagagagacggaggatatcagggctgctgaat
atgatggaaccaagtcttctgcagttctatgtttccaggcagtggttaaataaattcaag
acttttgcagagccaggaccaatttcaaataatgactttctctgtatgcatggaggtgtt
cctccacacaaagctaacttcatagaggatcttgttgtaatgctacctcaaaatatctgg
gacaatctgtatagcaggtacggaggaggaccagctgttaaccatctgtatgtttgtcac
acatgccaaatagagtctgaaagaattgaaaaaagaaggaaaaatgaattggaaatgttt
atacggcttaatagagcattccaagaagaagaatctccatcaacattttactgcatcagc
atgcactggttcagggaatgggaaggctttgtaaagggtaaagatagtgatcctcctggc
cccattgataatgctaagattgcagtaacaaaatgtggcaatactgtgctaaaacaaggt
gcagattctggacaaatatcagaagaaacatggaattttcttcagtcaatatatggtgga
ggtccagagattatactcagaccacctgttcctccagtagagcctgatatattgcaaaca
gaagagaagattgaattagaaactcatggtctgtag

DBGET integrated database retrieval system