KEGG   Taeniopygia guttata (zebra finch): 100229833Help
Entry
100229833         CDS       T01082                                 

Gene name
SCD
Definition
stearoyl-CoA desaturase (delta-9-desaturase)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
Class
Metabolism; Overview; Fatty acid metabolism [PATH:tgu01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:tgu01040]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:tgu03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 360 aa AA seqDB search
MPAHLLQEEEFSSTSNTTAGGTVTSRVTRNGNAVVEKDLLNHEDLAGDRGMIDDIFDETY
REKEGPKPPLRYVWRNIILMSLLHLGALFALTLIPSAKIQTLAWALLCFVVSALGITAGS
HRLWSHRSYKATLPLRIFLTIANSMAFQNDIYEWVRDHRVHHKFSETDADPHNAMRGFFF
SHIGWLLVRKHPDVIEKGQKLDLSDIKADKVVMFQRKYYKPSVVLLCFTLPAVVPWYFWD
ESIIISFFIPAILRYTVGLNATWLVNSAAHMFGNRPYDQNINPRENPLVSLGALGEGFHN
YHHTFPYDYSTSEFGWRFNLTTAFIDLMCLLGLASDRKKVSKEAILARKMRTGDGSHKSG
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgcacttgctgcaggaggaggagttctcctccacctccaacaccactgctggt
ggcacagtcacctcccgggtgaccaggaatggaaatgccgtcgtggagaaggacttactc
aatcatgaggacttggcaggagaccggggcatgatagacgatatctttgatgagacctac
cgggagaaggagggccccaagccccctctgcgatacgtctggaggaatatcatcctcatg
agcctgctgcacctgggggccctgttcgcgttgacgctgataccttctgcaaagatccag
acactggcgtgggctctcctgtgttttgtggtgagtgctctggggatcacagctggatct
caccgcctctggagtcatcgctcctacaaagccacactgcccctgcgcatcttcctgact
attgccaactccatggccttccagaatgacatttacgagtgggtccgggaccaccgtgtg
catcacaagttctccgaaacagacgcagacccacacaatgccatgcggggcttcttcttc
tcccacattggctggctgcttgtgcgcaagcaccccgacgtcatcgagaagggacagaag
ctggacctgagtgacataaaagctgacaaagttgtgatgttccagcgcaaatactacaag
ccttcagtggtgttgctgtgcttcacactgccagctgtagtgccctggtacttctgggat
gaatccatcatcatcagcttcttcattccagccatcctgcgctacaccgtagggctcaat
gccacttggctagtgaacagtgctgctcacatgtttggcaaccggccgtatgaccagaac
atcaacccacgggagaaccccttggtcagcctgggggccctaggagaaggcttccacaac
taccaccacactttcccctatgactactccaccagtgagtttggctggcgattcaacttg
accacagccttcatcgacctcatgtgcctcctggggctggccagtgatcgcaagaaggtc
tccaaggaggccatcctggctcggaaaatgcggactggagatggaagtcacaagagtggc
tga

DBGET integrated database retrieval system