KEGG   Taeniopygia guttata (zebra finch): 100229840Help
Entry
100229840         CDS       T01082                                 

Gene name
MAPK4
Definition
mitogen-activated protein kinase 4
Orthology
K06855  
mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100229840 (MAPK4)
Protein kinases [BR:tgu01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100229840 (MAPK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 458 aa AA seqDB search
GYLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCILAEMLTGRMLFAVSPKLSSSGVPA
VKTGYLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCILAEMLTGRMLFAGGHELEQMQ
LILETIPVIHQEDKEELLKVMPMFINSTWEVRKPLRKLLPEVDSEAIDFLEKILTFNPMD
RLTAEMGLQHPYMSPYSCPEDEPVSQHPFRIEDEIDDILLMEANQSQMSNWDSATSRYHI
SLSSDLDWRHDKHHEMDEVQRDPRAGSESTAEEAQVDPRKYSQSSSERFLELSHSSMDRV
FDADCGKSCDYKVGSPSYLDKLLWRDSKPHHYSEPKLILDLSHWKRATIAPAAELSLEEE
PSNLFLEIAQWVKSTQAGLECPSSLPEMQERSLPSSPHRLHEEPAEVSSETDPDFDLDVF
ISRALKLCAKPEDLPDNKLNEINGACISEHAGDQKERW
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
gggtacctctccgaaggcttggtgaccaagtggtaccgctccccccgcctcctcctgtcg
cccaacaactacaccaaagccatcgacatgtgggcagcgggctgcatcctggccgagatg
ctgaccgggaggatgctcttcgctgtttcaccaaaactttccagctcaggggttccagct
gtgaaaactgggtacctctccgaaggcttggtgaccaagtggtaccgctccccccgcctc
ctcctgtcgcccaacaactacaccaaagccatcgacatgtgggcagcgggctgcatcctg
gccgagatgctgaccgggaggatgctcttcgctggaggccacgagctggagcagatgcag
ctgatcctggagaccatccccgttatccaccaggaggacaaggaggagctgctgaaggtg
atgcccatgttcatcaacagcacgtgggaggtgcggaagccgctgcgcaagctgctgccc
gaggtggacagtgaagcgattgatttcctggagaaaatactgacatttaaccccatggat
cgattaacggccgagatgggcctgcagcacccctacatgagcccgtactcctgccccgag
gacgagccggtgtcccagcacccgttccgcatcgaggacgagatcgacgacatcctgctg
atggaggccaaccagagccagatgtccaactgggacagtgccacatccaggtaccacatc
agcctctcctccgacctggactggaggcacgacaagcaccacgagatggacgaggtgcag
cgggacccccgcgcgggctccgagtccacggcggaggaggcgcaggtggacccgcggaaa
tactcccagagcagctcggagcggttcctggagctgtcccactcgtccatggaccgcgtg
ttcgacgccgactgcgggaagtcgtgcgattacaaagtggggtcaccctcctacctggac
aagttgctgtggagggacagtaagccccaccactactcagagcccaagctaatcctggat
ttatcccactggaaaagggcgaccatagcccccgcagccgagctgtcgctggaagaggag
ccatccaacctgtttctggagatcgcccagtgggtgaagagcacgcaggcggggctggag
tgccccagctcgctgccggagatgcaggagcgcagcctgccctcctctcctcaccgcctg
cacgaggagcccgcggaggtgagcagcgagaccgaccccgacttcgacctggacgtcttc
atctccagggcgctgaagctttgcgcgaagcccgaggatcttccggacaacaagctcaac
gagatcaacggggcctgcatctcggagcacgccggggaccagaaggagcggtggtga

DBGET integrated database retrieval system