KEGG   Taeniopygia guttata (zebra finch): 100229860Help
Entry
100229860         CDS       T01082                                 

Gene name
MAP2K3
Definition
mitogen-activated protein kinase kinase 3
Orthology
K04432  
mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
MAPK signaling pathway
Toll-like receptor signaling pathway
GnRH signaling pathway
Influenza A
Module
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100229860 (MAP2K3)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100229860 (MAP2K3)
  Endocrine system
   04912 GnRH signaling pathway
    100229860 (MAP2K3)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100229860 (MAP2K3)
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100229860 (MAP2K3)
Protein kinases [BR:tgu01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100229860 (MAP2K3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
14
AA seq 348 aa AA seqDB search
MSLPRDSKGSLEPHKPVKGKKKRDLRITCVPIKPPVANTTPPRNLDSRTFITIGDKNFEV
EADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNTQEQKRLLMDLDISMRTVD
CFYTVTFYGALFREGDVWICMELMDTSLDKFYKKVLEKKKTIPEDILGKMAVSIVRALEH
LHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPE
LNQKGYNVKSDVWSLGITMIELAILRFPYESWGTPFQQLKQVVEEPSPQLPPERFSKEFV
DFTAQCLRKNPAERMNYLELMEHPFFTLHDTKETDMASFVTEILGEDS
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgcccagagattccaaaggatccttggagccacacaaaccagtgaaaggcaag
aagaagcgggatctgaggataacatgtgtccccatcaaaccacccgtggccaacacaacg
cccccgaggaacttggactccaggacgttcattaccattggagataaaaacttcgaggtg
gaagctgatgacctggtgaccatttcggagctgggccgtggggcctacggcgtggtggag
aaggtgcggcacgcgcagagcggcaccatcatggccgtgaagagaatccgagccactgtg
aacacgcaggagcagaagaggttgttgatggacctggacatctccatgaggacggtcgac
tgcttctacacagtcaccttctacggagccctcttccgtgagggtgacgtgtggatctgc
atggaactcatggacacttccctagataaattctacaagaaagtactggagaagaagaag
accatccctgaagacattttggggaaaatggctgtgtctattgtacgagctctggagcac
ctgcacagtaaactctctgtaatccatagagacgtgaaaccttccaacgtgctgatcaac
aaggaggggcacgtgaagatgtgcgactttgggatcagtggctacttggtggactctgtt
gccaagaccatggatgctggctgcaaaccctacatggctccagaaagaataaaccctgag
ctgaaccagaagggctacaacgtgaagtcggatgtctggagccttgggatcacaatgatt
gaactggccattctccgcttcccgtacgagtcctgggggacgcccttccagcagctcaag
caggtggtggaggagccctcgccccagctgccccctgaacgcttctccaaggagtttgtg
gacttcacagcacagtgcttgaggaagaacccagctgagcgaatgaactatttggaactt
atggaacacccgttcttcaccttgcacgacaccaaagagactgacatggcctcctttgtg
acagagatcctcggggaagactcctaa

DBGET integrated database retrieval system