KEGG   Taeniopygia guttata (zebra finch): 100229947Help
Entry
100229947         CDS       T01082                                 

Gene name
PFKP
Definition
phosphofructokinase, platelet
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100229947 (PFKP)
   01230 Biosynthesis of amino acids
    100229947 (PFKP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100229947 (PFKP)
   00030 Pentose phosphate pathway
    100229947 (PFKP)
   00051 Fructose and mannose metabolism
    100229947 (PFKP)
   00052 Galactose metabolism
    100229947 (PFKP)
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100229947 (PFKP)
Protein phosphatases and associated proteins [BR:tgu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100229947 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 783 aa AA seqDB search
MDHQPKFFENLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVNAKVYFIYEGYQGMVD
GGDNIVEVSWESVSSILQVGGTVIGSARCKPFRTREGRLQAALNLVQRGITNLCVIGGDG
SLTGANLFREEWSGLLEELAQKGKIDAEAVKKYAYLNIVGMVGSIDNDFCGTDMTIGTDS
ALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPEYPPEEGWE
DSMCTKLSENRARKKRLNIIIVAEGAIDCHNKPITSEKVKDLVVQRLGFDTRVTILGHVQ
RGGTPSAFDRILASRMGVEAVLALLEATPATPACVVSLSGNQAVRLPLMECVQMTQEVQK
AMDEGRFLEAVKLRGRSFENNLNTYKLLSHKKPDAELPKSNFNVAVLNVGAPAAGMNAAV
RAAVRVGITEGHKIFAVIDGFEGFARGKIKEISWGDVGGWTGQGGSILGTKRTLPAKYLE
KIADQMRTNNINALMVIGGFEAYLGLLELSAAREKYDEFCVPMVMVPATVSNNVPGSDFS
IGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGALAAGADAAYIFEEQ
FDIRELQANVEHLTEKMKTSIQRGLVLRNENCNENYTTDFIYQLYSEEGKGVFDCRKNVL
GHMQQGGAPSPFDRNFGTKISAKAMQWISKKLKETYRKGKVFANTDDSVCLLGIRRRNLV
FQPVAELKSETDFVHRIPKEQWWLKLRPLMKILAKYKTSYDVSDSGQLEHVAMLPKEAET
GAI
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggatcaccagcccaagttcttcgagaacctctcgggcgccgggaaggccatcggggtg
ctgaccagcggcggcgatgcccaaggtatgaatgctgctgtgcgcgcagtagtacgcatg
ggaatctatgtaaatgccaaagtctattttatttatgagggttaccagggaatggttgat
ggaggtgataatattgtagaagtttcatgggaaagtgtttcaagtatcctgcaagtggga
ggcacggtgatcggcagcgcgcgctgcaaacccttccgcacacgcgagggccgcttgcag
gctgccctcaacctggtgcagagaggcatcaccaacctctgcgtgatcggcggcgacggc
agcttgaccggcgccaacctcttccgggaggagtggagcgggctgctggaggagctggca
cagaaaggaaagattgatgcagaggctgttaagaaatatgcttatcttaacattgtggga
atggttggatccatagacaatgacttctgtggcactgatatgaccataggtactgactca
gctctgcacagaataattgaagttgtagatgccatcatgaccactgctcagagccaccag
aggacatttgttctggaggttatggggcgacactgtgggtatctagctctggttagtgcc
ttagcctgtggtgcagattgggtgtttattcctgaatacccaccagaagaaggctgggaa
gattcaatgtgtactaagctttcagagaaccgagcacgaaagaaaaggctgaatattatt
attgtagctgaaggagctattgattgtcacaacaaacctataacatcagagaaggttaag
gatcttgtggttcagcggcttggttttgacacccgagtaaccatcctgggtcatgtgcaa
agaggtggaaccccttcagcttttgatagaattcttgcgagtcgtatgggtgtggaagct
gtgcttgcccttttagaagctactccagctacccctgcctgtgttgtgtccctgtctgga
aaccaggctgtccgtctgcctctgatggagtgtgtgcagatgactcaagaagtccagaaa
gccatggatgagggaagatttcttgaggctgtgaagcttcgtggaaggagctttgaaaac
aaccttaacacgtacaaattactgtcgcacaaaaagccagatgccgaacttccaaagagt
aattttaatgtggcagttttaaatgttggtgcccctgcagctggaatgaatgccgccgtg
agggctgcagtgagagttggcatcactgaaggtcacaaaatatttgctgtcattgatggt
tttgaagggttcgctagagggaagataaaggaaatttcctggggagatgttggaggctgg
actggtcaaggaggatcaattcttggtacaaaacgtactcttcctgcaaaatatttggag
aagattgctgaccagatgcgcactaacaacattaacgcccttatggttattggtggattt
gaggcttaccttggacttctggaattgtcagctgcccgggagaaatatgatgaattctgt
gttccaatggttatggttcctgcaactgtatccaacaatgtaccgggttcagatttcagc
attggtgcagatactgctctgaacactataactgatacgtgtgaccgcatcaagcagtcg
gccagcggcaccaagcgccgcgtgttcatcatcgagaccatgggcggctactgcggctac
ctggccaacatgggggccctggcagcaggagctgatgctgcctacatcttcgaagagcag
tttgatatcagagagctccaggctaatgtggaacacttgactgaaaaaatgaaaaccagt
atccagcgtggtctagtgctgagaaatgagaactgcaatgagaactacacaactgatttc
atttatcagctgtattctgaagaaggaaaaggagtgtttgactgtcgaaaaaatgtactg
ggtcatatgcagcagggtggagcaccttcaccatttgatagaaattttgggacaaaaatt
tcagcgaaagctatgcagtggatctccaaaaaactgaaagaaacctaccggaaaggaaaa
gtatttgccaatactgatgactcagtttgtttgctgggaatacggagacgcaaccttgtt
ttccaacccgtggctgagctgaagagtgaaacagactttgtacacaggattcccaaggag
cagtggtggctgaagctgcgaccgctgatgaagatcctggccaagtacaagaccagctat
gatgtgtcagactcaggccagctggaacacgtggccatgctcccaaaggaagctgagacc
ggagccatctaa

DBGET integrated database retrieval system