KEGG   Taeniopygia guttata (zebra finch): 100229947Help
Entry
100229947         CDS       T01082                                 

Gene name
PFKP
Definition
phosphofructokinase, platelet
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100229947 (PFKP)
   01230 Biosynthesis of amino acids
    100229947 (PFKP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100229947 (PFKP)
   00030 Pentose phosphate pathway
    100229947 (PFKP)
   00051 Fructose and mannose metabolism
    100229947 (PFKP)
   00052 Galactose metabolism
    100229947 (PFKP)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    100229947 (PFKP)
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100229947 (PFKP)
Protein phosphatases and associated proteins [BR:tgu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100229947 (PFKP)
Messenger RNA biogenesis [BR:tgu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100229947 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 783 aa AA seqDB search
MDHQPKFFENLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVNAKVYFIYEGYQGMVD
GGDNIVEVSWESVSSILQVGGTVIGSARCKPFRTREGRLQAALNLVQRGITNLCVIGGDG
SLTGANLFREEWSGLLEELAQKGKIDAEAVKKYAYLNIVGMVGSIDNDFCGTDMTIGTDS
ALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPEYPPEEGWE
DSMCTKLSENRARKKRLNIIIVAEGAIDCHNKPITSEKVKDLVVQRLGFDTRVTILGHVQ
RGGTPSAFDRILASRMGVEAVLALLEATPATPACVVSLSGNQAVRLPLMECVQMTQEVQK
AMDEGRFLEAVKLRGRSFENNLNTYKLLSHKKPDAELPKSNFNVAVLNVGAPAAGMNAAV
RAAVRVGITEGHKIFAVIDGFEGFARGKIKEISWGDVGGWTGQGGSILGTKRTLPAKYLE
KIADQMRTNNINALMVIGGFEAYLGLLELSAAREKYDEFCVPMVMVPATVSNNVPGSDFS
IGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGALAAGADAAYIFEEQ
FDIRELQANVEHLTEKMKTSIQRGLVLRNENCNENYTTDFIYQLYSEEGKGVFDCRKNVL
GHMQQGGAPSPFDRNFGTKISAKAMQWISKKLKETYRKGKVFANTDDSVCLLGIRRRNLV
FQPVAELKSETDFVHRIPKEQWWLKLRPLMKILAKYKTSYDVSDSGQLEHVAMLPKEAET
GAI
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggatcaccagcccaagttcttcgagaacctctcgggcgccgggaaggccatcggggtg
ctgaccagcggcggcgatgcccaaggtatgaatgctgctgtgcgcgcagtagtacgcatg
ggaatctatgtaaatgccaaagtctattttatttatgagggttaccagggaatggttgat
ggaggtgataatattgtagaagtttcatgggaaagtgtttcaagtatcctgcaagtggga
ggcacggtgatcggcagcgcgcgctgcaaacccttccgcacacgcgagggccgcttgcag
gctgccctcaacctggtgcagagaggcatcaccaacctctgcgtgatcggcggcgacggc
agcttgaccggcgccaacctcttccgggaggagtggagcgggctgctggaggagctggca
cagaaaggaaagattgatgcagaggctgttaagaaatatgcttatcttaacattgtggga
atggttggatccatagacaatgacttctgtggcactgatatgaccataggtactgactca
gctctgcacagaataattgaagttgtagatgccatcatgaccactgctcagagccaccag
aggacatttgttctggaggttatggggcgacactgtgggtatctagctctggttagtgcc
ttagcctgtggtgcagattgggtgtttattcctgaatacccaccagaagaaggctgggaa
gattcaatgtgtactaagctttcagagaaccgagcacgaaagaaaaggctgaatattatt
attgtagctgaaggagctattgattgtcacaacaaacctataacatcagagaaggttaag
gatcttgtggttcagcggcttggttttgacacccgagtaaccatcctgggtcatgtgcaa
agaggtggaaccccttcagcttttgatagaattcttgcgagtcgtatgggtgtggaagct
gtgcttgcccttttagaagctactccagctacccctgcctgtgttgtgtccctgtctgga
aaccaggctgtccgtctgcctctgatggagtgtgtgcagatgactcaagaagtccagaaa
gccatggatgagggaagatttcttgaggctgtgaagcttcgtggaaggagctttgaaaac
aaccttaacacgtacaaattactgtcgcacaaaaagccagatgccgaacttccaaagagt
aattttaatgtggcagttttaaatgttggtgcccctgcagctggaatgaatgccgccgtg
agggctgcagtgagagttggcatcactgaaggtcacaaaatatttgctgtcattgatggt
tttgaagggttcgctagagggaagataaaggaaatttcctggggagatgttggaggctgg
actggtcaaggaggatcaattcttggtacaaaacgtactcttcctgcaaaatatttggag
aagattgctgaccagatgcgcactaacaacattaacgcccttatggttattggtggattt
gaggcttaccttggacttctggaattgtcagctgcccgggagaaatatgatgaattctgt
gttccaatggttatggttcctgcaactgtatccaacaatgtaccgggttcagatttcagc
attggtgcagatactgctctgaacactataactgatacgtgtgaccgcatcaagcagtcg
gccagcggcaccaagcgccgcgtgttcatcatcgagaccatgggcggctactgcggctac
ctggccaacatgggggccctggcagcaggagctgatgctgcctacatcttcgaagagcag
tttgatatcagagagctccaggctaatgtggaacacttgactgaaaaaatgaaaaccagt
atccagcgtggtctagtgctgagaaatgagaactgcaatgagaactacacaactgatttc
atttatcagctgtattctgaagaaggaaaaggagtgtttgactgtcgaaaaaatgtactg
ggtcatatgcagcagggtggagcaccttcaccatttgatagaaattttgggacaaaaatt
tcagcgaaagctatgcagtggatctccaaaaaactgaaagaaacctaccggaaaggaaaa
gtatttgccaatactgatgactcagtttgtttgctgggaatacggagacgcaaccttgtt
ttccaacccgtggctgagctgaagagtgaaacagactttgtacacaggattcccaaggag
cagtggtggctgaagctgcgaccgctgatgaagatcctggccaagtacaagaccagctat
gatgtgtcagactcaggccagctggaacacgtggccatgctcccaaaggaagctgagacc
ggagccatctaa

DBGET integrated database retrieval system