KEGG   Taeniopygia guttata (zebra finch): 100229974Help
Entry
100229974         CDS       T01082                                 

Gene name
USP25
Definition
ubiquitin specific peptidase 25
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
tgu  Taeniopygia guttata (zebra finch)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 1045 aa AA seqDB search
MVANIVHQMFSYCHTGSVCQTSAALGDHQQTFLNQLREITGINDIQVLQKALKDSNGNLE
LAVAFLTAKNAKVPQLEEATYYQTALPGNDRYISVGSQADTNVIDLTGDDKDDLQRAIAL
SLEESNRAFRETGITDEEQAISRVLEASIAENKASLKRTHPEVWSDSPNPYDRKRQDNCP
VGLKNVGNTCWFSAVIQSLFNLLEFRRLVLNFNPPANAQDLPRNQKEHRNLPFMRELRYL
FALLVGSKRKYVDPSRAVEILKDAFKSNDSQQQDVSEFTHKLLDWLEDAFQIKAEEERDG
EKPKNPMVELFYGRFLAVGVLEGKKFENTEMFGQYPLQVNGFKDLHECLEAAMIEGEIES
LHSENSAKSGQEHWFTELPPVLTFELSRFEFNQALGRPEKIHNKLEFPPILYLDRYMHKN
REITRIKRDEIKRLKEYLTVLQQRLERYLSYGSGPKRFPLVDVLQYALEFASSKPVCTSP
VDDLGASAPASGTLPPQIPPSTIEQQGPSSSDVPSTSPVQRSVIHKPFTQSRIPPDLPMH
PAPRHITEEELSVLEGCLHRWRTEVENDTRDLQESISRIHRTIELMYSDKTMVQVPYRLH
AVLVHEGQANAGHYWAYIYDHHQNRWMKYNDISVTKSTWEELERDSFGGYRNASAYCLMY
INDKEQYLIQEEFNKETGQMLVGMDTLPSDLRDYVKEDNKRFEKELEEWDAELAQKAQQE
KLLSQIPRAPAPSPAPVQAGEPEYLEQPSRTDISKHLKEDSVQAINKALAEQEDRGPEAI
MDTAIKLEYTRLLKLAQEDPPPECDYRLRHAIVYFIQNQAPKKIIERTLLEQFGDHNLSF
DERCRNIMKVAQAKLEMIKPDEVNMEEYERWHQDYRHFRETTMFLMVGLEFFQKKSYMEA
LLYLIYAYQNNKELLSKGPYRGHDEELISHYRRECLLVEAVVDCCYMEALLYLIYAYQNN
KELLSKGPYRGHDEELISHYRRECLLFAANLQEKLTDFLPKLLDCSTEIKGFNDPPKLPS
YSTHELCERYARIMLSLSRTPADGR
NT seq 3138 nt NT seq  +upstreamnt  +downstreamnt
atggttgcaaacattgttcatcagatgttttcttactgtcatacaggaagcgtgtgtcaa
acttcagcagcacttggagatcaccagcaaacatttttaaatcagctgagggagatcacc
ggtatcaatgacatccaggtactacaaaaggcactgaaggacagcaatggtaatctggag
ctggctgtggcttttctcactgcaaagaatgccaaggttccccagctagaggaggcaact
tactaccaaacagcccttcctgggaatgacagatacatcagcgtgggcagccaggcagac
accaatgtgattgatctcactggagatgataaagatgatcttcagagggcaattgccttg
agtttggaggagtcaaacagggcattcagggagactggaataacagatgaggaacaagcc
attagcagagttctagaagccagtattgcagaaaataaagcgagtttaaagaggacgcat
ccagaggtgtggagtgactctccaaacccttatgatcgaaagcggcaagacaactgccca
gtaggattaaagaatgttggcaacacgtgctggtttagtgctgtcattcagtcattattt
aacctactggagtttcgaagactagttttgaatttcaatcctcctgcaaatgctcaagat
ttaccccgaaaccaaaaggaacataggaatctgcctttcatgcgtgaattgaggtacctg
tttgcacttctagttggttcaaagagaaaatatgttgatccatcaagagcagttgaaatc
cttaaagatgcttttaaatcaaatgattcccagcagcaagacgttagtgaatttacacac
aaattattagattggctggaagatgccttccaaattaaagctgaagaggagagggatgga
gagaaaccaaagaacccaatggtggagttgttttatggacgattcctagcagtaggtgtg
cttgaaggtaaaaaatttgaaaacacagaaatgtttggccagtatccactacaggttaat
ggctttaaagatctgcatgagtgcctagaagctgcaatgattgaaggggaaattgaatct
ctccactcagaaaactctgccaagtctggtcaagagcactggttcacagagcttcctcct
gtcttaacctttgagctatcaagatttgaatttaatcaggccttggggagaccagagaag
atacacaacaaattagaatttcctccaattttgtatctagacaggtatatgcacaaaaac
agagaaataacaagaattaaaagagatgaaatcaagagactcaaagagtacctcacagtt
ttacaacagagactagaacgatatttaagctatggttctggtcctaaacgattccccttg
gtagatgtcctgcagtatgccctggagtttgcctccagcaagccggtgtgcacgtccccc
gtggatgacctgggtgccagtgcccctgccagcggcacactgccaccacagatccccccc
agcacaatagagcagcaggggccttcatcatcagatgtcccaagcacatctcctgtacaa
agatcagtaatacacaaaccattcacacaatcacggattccccctgacctgccgatgcat
ccagcaccaaggcacatcacggaggaggagctgtctgtcctggagggctgtttgcatcgc
tggaggactgaagtagagaatgacacaagagatttacaagaaagtatatctagaatacat
cggacaattgaattgatgtactctgacaaaacaatggtccaagttccttataggttgcat
gctgtcctagttcatgagggtcaagcgaatgcaggacactactgggcatatatttatgac
caccaccaaaacagatggatgaaatataatgatatttctgtgacaaagtcaacttgggaa
gagttggaacgagactcttttggtggttacaggaatgccagtgcatattgtttaatgtat
atcaatgacaaggagcagtacttgatacaagaggagtttaacaaagaaacggggcagatg
cttgttggaatggacacgctgccttctgatctaagggattatgtcaaggaagacaataaa
cgttttgaaaaagaacttgaagagtgggatgcagaacttgctcagaaagcacagcaggag
aaattattatctcagatacccagggcaccagcaccctcacctgctccagttcaagcagga
gaaccagagtatttagagcagccatcaagaactgatatttcaaagcacttaaaagaagat
tctgtacaagcaatcaataaagctttagctgaacaagaagacagaggtccagaagctata
atggatacggcaattaaattggaatacacacgtctgctaaaattagcccaggaagatcca
ccacctgaatgtgattatcgtttgcgtcatgcaattgtttacttcatccaaaaccaggca
ccaaagaagataattgagaggacattattggagcagtttggagatcacaatctcagcttt
gatgaaaggtgtcgtaacataatgaaggttgctcaagccaaacttgaaatgataaagcca
gatgaagtaaacatggaggaatatgagagatggcatcaagactatagacatttcagggaa
acaaccatgtttcttatggtaggattggagtttttccaaaaaaagagttacatggaagcc
ttgctctaccttatctatgcttaccagaataacaaagaactcttgtccaaaggcccatac
agagggcacgacgaagagctgatatctcactacagacgagagtgtttgctagtggaagca
gtggttgactgttgttacatggaagccttgctctaccttatctatgcttaccagaataac
aaagaactcttgtccaaaggcccatacagagggcacgacgaagagctgatatctcactac
agacgagagtgtttgctatttgcagccaacttgcaagaaaaactgacagatttcctgcca
aaactgctagattgttctacagagattaaaggtttcaatgacccgccaaagttaccctcc
tactccacacatgaactgtgtgaaagatacgcccgaatcatgttgtcactcagtcgaact
ccagccgatggaagataa

DBGET integrated database retrieval system