KEGG   Taeniopygia guttata (zebra finch): 100230062Help
Entry
100230062         CDS       T01082                                 

Gene name
CYSLTR2
Definition
(RefSeq) cysteinyl leukotriene receptor 2
  KO
K04323  
cysteinyl leukotriene receptor 2
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100230062 (CYSLTR2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100230062 (CYSLTR2)
G protein-coupled receptors [BR:tgu04030]
 Class A. Rhodopsin family
  Other
   Cysteinyl leukotriene
    100230062 (CYSLTR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
1
AA seq 314 aa AA seqDB search
METLAQTMNISKVAVDGSFTNSSSNCTIDGFKQVIYPIVYLFIFFPGAVGNSLSIYVFFQ
TSQRTSVNIYMQNLAISDLMFVSTLPFRASYFLLGSHWIFGDILCRIMTYSLYMNMYCSI
YFLAVLSVVRFVAIVHPFKHGQVTNTKYARITCAAIWIFVLLAASPLLNKGIAGYSNPVK
CLDLHPPSTHRLLMMNSFVLVVGFILPFCTILFCYVFAIRALLKSRAQRSRRAICHRKAL
LTIVITLILSLICFLPYHILRTVHLLYSGCSQARLHKALVVTLCLAAMNNCLDPFLYYFA
AENFKAKIRSLCCR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggagacgctggctcagactatgaacatttccaaggtggcagtagatggcagcttcact
aacagctcctccaactgtacaattgacggtttcaaacaagtaatttatcccatcgtgtat
ctctttatcttcttcccgggtgctgttggaaacagcctctctatttatgttttcttccag
acttcgcaaaggacctcagtaaacatttacatgcagaacttggctatttcagacctcatg
tttgtgagcactttgccctttcgggcctcatatttcctcttgggatcacattggatattt
ggcgacatcctctgcaggatcatgacttacagcttgtacatgaatatgtactgcagcatt
tatttcctcgctgtgctcagcgtggttcgttttgtagccatcgtccaccccttcaaacat
ggacaagtgaccaacacgaagtatgccaggattacctgtgcagccatatggatctttgtg
ctgttagctgccagccctctgttaaacaagggaatcgctggctacagcaacccagtcaaa
tgcttggacctccacccccccagcacacacaggctcctcatgatgaacagctttgtcctc
gtcgtgggcttcattctgccattctgcacaattttgttctgctatgtctttgccatcaga
gcgctgctcaagtccagggctcagcggagcaggagggcaatctgtcacaggaaggcactg
ttaaccattgtcatcactctcatcctctccctcatctgtttcctgccatatcacatcctg
cgcactgtccacctgctgtatagcggctgcagccaggccagactgcacaaggcgttggtg
gtcactctctgcctcgctgccatgaacaactgcctcgacccttttctctattactttgct
gctgaaaatttcaaagcaaaaatcagaagtttgtgctgcagatag

DBGET integrated database retrieval system