KEGG   Taeniopygia guttata (zebra finch): 100230131Help
Entry
100230131         CDS       T01082                                 

Gene name
ALDH1L2
Definition
(RefSeq) aldehyde dehydrogenase 1 family, member L2
  KO
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    100230131 (ALDH1L2)
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     100230131 (ALDH1L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
1A
AA seq 1083 aa AA seqDB search
MQALARRQRHRRGLHQTRRSAAAAEPARCWPGGRKMLRTAPRLLRTICTTAAVSSAGRAA
SDPGPPCCAVPSPAANRSRGSRKDGDGWSGYFPGCDAYRLCRGFSKALQARQGLERARCG
HGAARLFGERVAAIIWALHLAGMCLEAAGIGRQRCCDSDPDLEDMFQTHKLCLEKVFYAY
QHKLKLALIGQSIFGQEVYNKLRKEGHKVVGVFTVPDKNGQADPLALAAEKDGTPVFKFP
RWRAKGKPIQEVVAAYKSVGAELNVLPFCTQFIPMDVIDCPKHGSIIYHPSILPRHRGAS
AINWTLIQGDKKAGFTIFWADDGLDTGPILLQRECDVGQNDTVDDLYNRFLFPEGIKAMV
EAVHLIADGKAPRIPQPKEGATYEGIQKKENAEISWNQPAAALHNWIRGHDKVPGAWATI
NGQVVTFYGSSLLDASVPAGQELAIKGASRPGLVTKNGLVVFGNDGKMVLVRNLQFEDGK
MIPASKYFSADETTALELTEEEKKIAEDIRAIWKGILSNVAVIEDSTDFFKSGASSMHVV
RMLEEIKQKHGGLQLQNEDVYMATKFADFIQMAVRKLRGEDKEEELVIDYVSKNMNNMTV
NMPYQCFINGKFIDADDGKTYDTINPADGSVIASVSSASLADVDKAVAAAKEAFENGEWG
RMNARERGRLMYRLADLMEEHQEELATIESIDSGAVYTLALKTHIGMSVQTFRYFAGWCD
KIQGATIPINQARPNHNLTFTKKEPIGVCAIIIPWNYPLMMLAWKTAACLAAGNTLVLKP
AQVTPLTSLKFAELSAKAGFPKGVINILPGSGGLVGQHLSEHPDVRKVGFTGSTPTGKQI
MKSAATNLKKVSLELGGKSPLIIFSDCELDRAVKMGMGAVYFNKGENCIAAGRLFVEESI
HDEFVRKVVEEIKKMKIGDPLDRSTDHGPQNHKAHLEKLLQYCETGVKEGATLVYGGRQV
HRPGFFMEPTVFTDVEDHMYIAQEESFGPVMVISKFKNGDVDGVLRRANATEYGLASGVF
TKDINKALYISEKLEAGTVFINTYNKTDVAAPFGGFKLSGFGKDLGEEALHEYLRTKAIT
VEY
NT seq 3252 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcgctggcccggcgccagcggcatcggcgcgggttgcatcagacgaggcgctcc
gccgcggccgcggagccggctcggtgttggccgggcggccgcaagatgctgcggacagca
ccccggctgctgcggaccatctgcaccacggctgcggtgagtagcgcggggcgggcggct
tcagacccgggtcccccgtgctgtgccgtgccgagcccggcagcgaaccggtcgagggga
agccgcaaggacggggatggctggagcgggtattttccaggatgtgatgcctatcgtctc
tgccgaggattcagcaaagccctgcaggcacggcagggtctggaaagggctcggtgtggg
cacggagctgcccggctgttcggcgagagggtcgcagccatcatctgggcgctgcatctt
gcagggatgtgcctggaagctgcggggatcgggcgccagcgatgctgtgatagtgacccg
gatttagaggacatgttccagacacataaattatgcctagaaaaagtgttttatgcttat
caacataagctaaagctagcccttataggtcaaagtatttttggacaagaagtttataac
aagctgagaaaagaagggcataaagttgtgggtgtattcaccgtgcctgacaagaatgga
caagctgatcctttggcactggcagcggagaaggacggcactcctgtttttaagttcccc
agatggagagctaaaggcaagcctatccaggaagtagttgcagcctacaaatcagttgga
gcagagttaaatgtccttccattctgtacacagtttatccccatggatgttattgactgc
ccaaaacatggctctattatttaccatccatccatcctaccacgccaccgaggagcttct
gcaatcaactggactttaattcaaggagataagaaagcaggatttactatattttgggct
gatgatggcttggacactggaccaatacttctgcagcgagaatgtgatgttggccaaaat
gacaccgtagatgacctatataaccggtttctcttcccagaaggaataaaggccatggtg
gaagctgtacatctaattgctgatggtaaggcccctcgtatacctcagcctaaagaaggg
gcaacatatgaagggatccagaagaaggaaaatgcagagatctcctggaaccaacctgca
gcagctttgcacaattggattcgagggcatgataaagtacctggagcatgggcaacaata
aatggacaggtggttactttttatgggtcatcattacttgatgcttcagtgcctgctgga
caagagttggcaataaaaggtgcttcaagaccaggacttgtgacaaagaatggtctagtt
gtttttggaaatgatgggaagatggtactagtgagaaatctgcagtttgaagatggaaaa
atgatccccgcatctaaatacttctctgctgatgaaacaactgccctggaacttacagaa
gaggagaaaaagattgcagaagatatcagagctatttggaagggaattttaagcaatgtt
gctgtgattgaggattccacagacttcttcaaatctggagcatcctctatgcatgttgtc
aggatgctagaagagatcaaacagaagcatggtggactgcagctacagaatgaagatgtg
tatatggccactaagtttgcagactttattcagatggctgtcagaaaactcagaggagaa
gacaaagaagaagagttagtcattgattatgtttcaaaaaatatgaacaacatgactgtg
aatatgccataccaatgtttcataaatgggaagtttatagatgctgatgatggaaaaaca
tatgacactataaatccagcagatggatcagtaatagccagtgtatcttctgcctcactg
gctgatgttgacaaggcagtggcagcagcaaaggaggcatttgaaaatggtgaatggggg
aggatgaatgcaagggaaagagggcgactcatgtacagacttgcagacctgatggaagaa
catcaagaagagttagcaacaatagagtctattgactcaggagctgtctacactttagct
ctgaagactcatattggaatgtctgtacaaacattcagatactttgctggatggtgtgac
aaaattcagggtgctacaattccaattaatcaggcccggccaaaccataatctaacattc
accaagaaagagccaattggtgtctgtgcgattattatcccctggaattacccactgatg
atgcttgcatggaagaccgcagcgtgcttggctgcaggcaacaccctcgtactcaaacca
gctcaggtcacacctctgacttccttgaagtttgcagaactctcagctaaagctggattt
cctaagggcgttataaatattctgccaggttcaggtggtttagtgggacagcacctctct
gaacatccagatgttcgcaaagttggattcaccggttcaacaccaactggtaaacagatc
atgaagagtgcagctactaacctgaagaaagtttctctggaacttggtggaaaatcacca
ttgatcatattcagtgactgtgaacttgacagagccgtaaaaatgggtatgggagcggtg
tatttcaacaaaggagaaaactgcattgcagctggcaggctgtttgtggaagaatcaatt
catgatgagtttgttagaaaagtggttgaagaaataaaaaagatgaaaattggtgaccca
cttgatagatctacagatcatggtccacaaaatcacaaggcacatttggaaaagctgctg
caatactgtgaaactggagtaaaagaaggagccactctagtgtatggaggaagacaagta
catagaccaggtttcttcatggaacccactgtattcacagatgttgaagatcatatgtat
attgcccaggaagaatcctttggtcctgtgatggtcatctctaaatttaaaaatggagat
gtcgatggagtattgcgacgggcaaatgccacagaatatggcttagcttcaggagttttc
acaaaagacataaacaaagctctctacatcagtgaaaagctagaagctgggacagttttt
attaacacgtacaacaaaactgatgtggcagcgccatttggtggatttaagctgtctggc
tttgggaaagatttaggtgaagaagctcttcatgaatatctcagaaccaaagccatcact
gtggaatattaa

DBGET integrated database retrieval system